KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_0803Help
Entry
NMV_0803          CDS       T01928                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase (HDH)
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00340  Histidine metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NMV_0803 (hisD)
Enzymes [BR:nmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NMV_0803 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAX49688
Position
complement(784744..786033)
Genome map
AA seq 429 aa AA seqDB search
MKKLNTQSPDFQAGLKALLAFETAQNPETERIVADICADVQKRGDAALIEYTNKFDQTNA
KSIDDLILTQADLKAAFERIPNDVQTALQTAARRVESYHQRQKMESWSYTDEDGTLLGQQ
ITPLDRVGIYVPGGKAAYPSSVIMNAMPAHVAGVKEIIMVVPTPKGERNDIVLAAAYVAG
VTKVFTVGGAQAVAALAYGTETIPQVDKITGPGNAFVAAAKRRVFGVVGIDMVAGPSEIL
VIADGTTPADWVAMDLFSQAEHDEIAQAILIGTSQAYLDEVEAAMDRLIETMPRRDIIEA
SLGNRGAMILAKDLDEACEIANYISPEHLELSVENPQEWAKKIRHAGAIFMGRYTGESLG
DYCAGPNHVLPTSRTARFSSPLGTYDFQKRSSLIQVSEQGAQKLGETASVLAHGESLTAH
ARAAEFRMK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaacacccaatcgcccgatttccaagccggactcaaagccctgctggct
tttgaaaccgcgcaaaaccccgaaaccgaacgcatcgtcgccgacatttgcgccgacgtg
caaaagcgcggcgatgcggctttgattgaatacaccaacaaattcgatcagacaaacgct
aaaagcatcgatgatttaatactcacgcaagccgatttgaaagcggcgttcgagcgcatt
ccgaacgacgttcagacggcattgcagaccgccgcccgccgtgtcgaaagctaccaccaa
cgccaaaaaatggaatcgtggagctacaccgatgaagacggcacgctgttgggacaacaa
atcacaccgcttgaccgcgtcggcatttacgtccccggcggcaaggcggcgtatccgagt
tccgtcatcatgaacgccatgcccgcccacgtcgcaggtgtgaaagaaatcatcatggtc
gtgccgacaccaaaaggcgaacgcaacgacatcgtacttgccgccgcatacgtcgccggc
gtaaccaaagtcttcaccgtcggcggcgcgcaggcggttgccgccctcgcctacggcacg
gaaaccatcccccaagtcgataaaatcaccggtccaggcaacgccttcgtcgccgccgcc
aaacgccgcgtgttcggcgtggtcggcatcgacatggtggcggggccgtctgaaatcctg
gtcatcgccgacggcacgacacctgccgattgggtggcgatggatttgttcagccaggcc
gaacacgacgaaattgcccaagccatcctcatcggcacgtcgcaagcgtatctcgacgaa
gtagaagccgctatggaccgcctgatcgaaactatgccgcgccgcgacatcatcgaagcc
tcgctcggcaacaggggcgcgatgatactcgccaaagacttggacgaagcctgcgaaatc
gccaactacatttcccccgaacacttggaactgtcagtcgaaaatccgcaggaatgggcg
aaaaaaatccgccacgccggtgcgattttcatgggacgctacaccggcgaaagcctcggc
gactactgcgccggtccaaaccatgtattgcccaccagccgaaccgcccgcttttcctcg
cctttggggacatatgatttccaaaaacgctccagcctgattcaggtttcggaacagggc
gcgcaaaaattaggcgaaaccgccagcgtgctggcacacggcgaaagcctgaccgcccac
gcccgcgcggcagagttccgtatgaaataa

DBGET integrated database retrieval system