KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1055Help
Entry
NMV_1055          CDS       T01928                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase (pyruvate dehydrogenase E2 component; dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00010  Glycolysis / Gluconeogenesis
nmt00020  Citrate cycle (TCA cycle)
nmt00620  Pyruvate metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
Module
nmt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMV_1055 (aceF)
   00020 Citrate cycle (TCA cycle)
    NMV_1055 (aceF)
   00620 Pyruvate metabolism
    NMV_1055 (aceF)
Enzymes [BR:nmt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NMV_1055 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DEC-1_N HlyD_D23 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: CAX49922
Position
complement(1059287..1060858)
Genome map
AA seq 523 aa AA seqDB search
MSIVEIKVPDIGGHENVDIIAVEVKVGDTIAVDDTLITLETDKATMDVPADAAGVVKEVK
VKVGDKISEGGVILTVETGAAAAEAQPAPAAAPVAAGGATVQVAVPDIGGHTDVDVIAVE
IKVGDTVAEDDTLITLETDKATMDVPCTAAGVVKAVFLKVGDKVSEGSAIIEVETAGSAA
AAPAQAAAPAPAAAPAPTAVAAPAPSAPAAAKIDEAAFAKAHAGPSARKLARELGVDLGQ
VKGTGLKGRIVGDDIKAFVKSVMQGGAAKPAAAGASLGGGLDLLPWPKVDFSKFGNVEVK
ELSRIKKISGQNLSRNWVVIPHVTVHEEADMTELEEFRKQLNKEWEREGVKLSPLAFIIK
ASVSALKAFPEFNASLDGDNLVLKNYFNIGFAADTPNGLVVPVIKDVDQKGLKQISQELT
ELSKKAREGKLKPQEMQGACFTISSLGGIGGTGFTPIVNAPEVAILGVCKSQIKPIWNGK
EFAPRLMCPLSLSFDHRVIDGAAGMRFTVFLAKLLKDFRRITL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgtagaaatcaaagtccctgatatcggcggtcatgaaaacgtcgacatcatc
gccgtagaagtcaaagtaggcgacactattgccgttgacgacaccctgattactttggaa
accgacaaagccactatggatgtacctgctgatgcagccggtgttgttaaagaagttaaa
gttaaagtgggcgataaaatctctgaaggcggcgttattctgaccgttgaaaccggtgcc
gccgctgccgaagcacaacctgcacctgctgccgcacccgttgccgcaggcggtgcaacc
gttcaagtagccgttcccgatatcggcggccataccgatgtggatgtaatcgccgttgaa
atcaaagtgggcgacaccgttgccgaagacgacacgctgattactttggaaaccgataaa
gcgacaatggacgtaccttgtaccgctgccggtgtcgttaaagccgtattcttaaaagtc
ggcgacaaagtgtccgaaggctctgccattatcgaagtagaaaccgccggctctgccgca
gcagcccctgctcaagccgccgcacccgcaccggctgccgccccggctccgactgctgtc
gccgcgcctgcaccttctgcacctgccgctgccaaaatcgacgaggccgctttcgccaaa
gcacacgccggtccttccgcacgcaaactggcgcgcgaattgggcgtggatttgggccaa
gtcaaaggtaccggcttgaaaggccgcatcgtgggcgacgacatcaaagcctttgtgaaa
tccgtaatgcagggcggtgcggcaaaacctgccgcagccggcgcatctttgggcggcggt
ctggacttgctgccgtggcctaaagtggacttctccaaattcggcaatgtcgaagttaaa
gaattgtcccgcattaagaaaatttccggtcaaaacctgtcccgcaactgggttgtgatt
ccccacgttaccgtacacgaagaagcggatatgactgagctggaagaattccgcaaacag
ctgaacaaagaatgggaacgcgaaggcgtgaaactgtcaccgttggcgttcatcatcaaa
gcctccgtttccgcgctgaaagccttccccgaattcaacgcttctctggacggcgacaac
ctggtgctgaaaaactacttcaacatcggtttcgcagccgatacgccgaacggcttggtt
gttcccgtcatcaaagacgtggatcaaaaaggcttgaaacaaatcagccaagagctgacc
gaattgtccaaaaaagcccgcgaaggcaagctcaaaccgcaagaaatgcaaggcgcgtgc
tttaccatttccagcttgggcggtatcggcggcacaggcttcacaccaatcgtgaatgct
cctgaagttgctatcttgggcgtgtgcaaatcccaaatcaaaccgatttggaacggcaaa
gagtttgccccgcgcctgatgtgcccgttgagcctgtccttcgaccaccgcgtcatcgac
ggtgcggccggtatgcgctttaccgtattcttggcgaagctgttgaaagacttccgccgc
attaccctgtaa

DBGET integrated database retrieval system