KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1103Help
Entry
NMV_1103          CDS       T01928                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (FAPY-DNA glycosylase; DNA-(apurinic or apyrimidinic site) lyase MutM; AP lyase MutM) (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nmt03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1111159..1111986
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETTLRGIAPHIEGKTVEAVVLRQLKLRWQINPDLGEILSGRQVLSCGRRAKYL
LIRFQTGVLLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAIL
WYEGIEEHHPLLEKLGPEPLSEAFCADYLYARLKAQKRAVKLALMDNAVVVGVGNIYANE
SLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEY
TVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattgccggaagtggaaacgacgttgcgcggcatcgcgccgcatattgaaggg
aaaacggtggaagccgtggtattgcgccaattgaagctgcgctggcagattaatcccgat
ttgggggagattttgtccggccggcaggtgttgtcctgcggcaggagggcgaaatacctg
cttatccgctttcaaacgggcgtgctgctgattcacttggggatgtcgggcagcttgcgg
atttttacgccgtcggacggacgtatcggcaggccggacagacacgatcacgtcgatatt
gtgttttcagacggcacggtcatgcgttaccgcgatccgcgaaagttcggcgcgatactt
tggtatgagggaattgaagagcatcatccgctgctggaaaaactggggccggagcctttg
tcggaggcattttgtgcggattatctgtatgcaaggctgaaggcgcagaagcgcgcggtc
aaacttgccctgatggacaatgcggtcgtggtcggtgtgggcaacatttatgccaacgag
agcctgtttagggcgggcatttcgccccaccgtcctgccaaccgcctgaaaaagaaagag
tgtgcgcttttggttgaaaccgtcaaagcggtgttgcggcgcgccattgaaacgggcggc
agtacgctgagggactttgtggacagcgacggcaaaagcggctacttccaacaggaatat
acggtgtacgggcggcacaatcagccgtgcccccagtgcggcggtttggttgtgaaagaa
actttggggcagcgcggcacgttttactgcccgaattgtcagaaatag

DBGET integrated database retrieval system