KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1161Help
Entry
NMV_1161          CDS       T01928                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMV_1161 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMV_1161 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMV_1161 (thrC)
Enzymes [BR:nmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMV_1161 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1175386..1176795)
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGREALDKWRGLAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
NATSSNDETVSFCVPSGNFGNVCAGHIAKQMGLPVRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWTEVAAGKGFDLQFALDKVGG
KYGFTSGKSTHADRLATIKQVYEQDQELIDPHTADGVKVAREVREEGETVVCLETALAAK
FDATICEAVGDVAIPRPAALEGLENLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcacccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgg
gaagccttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaatcatgcgc
ttgttcgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctatcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgca
accagcggtgatacgggttcggctgcggaatatgccttgcgcggcaaaaagggcgtaaac
gtatttatgctgtcgcccgatggcaaaatgagtgcgttccaacgtgcgcagatgtacagc
ctgcaagacgggaatatccacaatatcgccgtgaaggggatgtttgacgactgtcaggac
attgtgaaggcggtgcagaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aactcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aacgccacttcaagcaatgacgaaaccgtcagcttctgcgtaccgagcggcaacttcggc
aacgtttgcgcgggacatattgccaaacagatgggcctgcctgtccgccgcctgattgtt
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggcgcgtaccgcccgcgc
aacagcgcgcatacttatgttacctccagcccgtctatggacatttccaaagcgtccaat
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgg
acggaagtcgcggcgggcaagggctttgacttgcagtttgccttagacaaagtcggcggc
aaatacggctttacctccggcaaatctacccacgccgaccgcctcgccaccatcaaacag
gtttacgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggggaaacggtggtttgtttggaaaccgcgttggcagcgaaa
ttcgatgcgaccatatgcgaagccgtcggcgatgtcgccattccgcgtcccgccgcgctg
gaaggtttggaaaacctgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system