KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1193Help
Entry
NMV_1193          CDS       T01928                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMV_1193 (recR)
DNA repair and recombination proteins [BR:nmt03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMV_1193 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1208869..1209486
Genome map
AA seq 205 aa AA seqDB search
MSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVYHCA
MCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggttttaccc
aacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgcaaa
gaggctgaaaaactggtggatgccttgcagacggcattgaagcaggtttaccattgcgcg
atgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaagaa
atcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtccgag
ttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcattcccttgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctgatt
aaagaaggcggggcataa

DBGET integrated database retrieval system