KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1197Help
Entry
NMV_1197          CDS       T01928                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMV_1197 (recD)
Enzymes [BR:nmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     NMV_1197 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1212028..1213773
Genome map
AA seq 581 aa AA seqDB search
MERQTDEFAQAAARAAIRFLARYAGSGSEVLANCTERLFQALQNGHSFIRLSGGEADALS
ALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAADTSAPDAAGARQNLAKWF
QGTGSEGQRDAAALALLQSFMVITGGPGTGKTTTVAKLLALICGEDENLPNIALAAPTGK
AAAHMARALHRAINGFDAPEAVRRHLLKLEGQTVHRLLKLRPPKMQAAFNPVYPLPFDVL
VIDEASMLDTVLMLQLLKAVKTGARVILLGDENQLPSVGIGDVLSVLSQKTVLDGETHQR
LAGFLPEHGFSVSANPPLLAQNTAHLSFSHRFGDNSGIGCLARAAVSGDEGAWALFDQFP
DELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAWRQDAEDFNEAY
CSHVRRKMNIPEHQAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQGSLAAYFADADG
FKKVAVSCLPDFEPAFAMTVHKSQGSEYREVWLLPPSAAPSDEGDDALSGLSKELLYTAI
TRAREKFVFFGGEETFRQAAATVKTRQTALGSMLERVFSQE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcagacagatgaatttgcccaagcggcggcaagggcggcaatccgttttttg
gcacgctatgcgggttcgggcagcgaagtgcttgcaaactgcaccgaacgcctgtttcag
gcattgcaaaacggtcattcgtttatccgtttgagcggtggcgaggctgacgcgctgtcg
gcactcgcacccgtggtcggaacatccgccgcgcctttgattttggaaggcagaaggctg
tttttgggcaggatgtggcagttggaatacgatttggctgccgagataaaacgcttggcg
gcagccgacacgtccgcccccgacgcggcaggcgcgaggcaaaacctcgcaaaatggttt
caaggcacgggcagcgaagggcagcgcgatgccgccgccttggcactgttgcagtctttt
atggtgattaccggcgggccgggaacgggcaaaacgacaacggttgccaaactgctggcg
ctgatttgcggtgaagacgaaaatcttcccaacatcgcgcttgccgcaccgacgggcaaa
gcggcggcacatatggcgcgcgcgctgcaccgtgcaatcaacggttttgacgcgccggag
gccgtccgccgccatttgctcaaactggaagggcaaaccgtccaccgactgctgaagctg
cgcccgcccaaaatgcaggcggcgttcaaccctgtttacccgctgccgtttgacgtattg
gttatcgatgaagcctctatgctggatacggtattgatgttgcaacttttaaaagcggtc
aaaaccggcgcgcgcgtgattctgctgggcgatgaaaaccagctcccgtccgtcggaatc
ggggacgtgctgtccgtcctgtcgcaaaaaaccgttttggacggagaaacgcaccaaagg
ctggccggcttccttccggaacacggtttcagcgtcagtgcaaatccgcccttgttggcg
caaaacaccgcccatctgtcgttcagccaccgcttcggcgacaacagcggcatcggctgc
cttgcccgtgccgccgtatcgggcgatgagggggcgtgggcattgtttgaccagtttccg
gacgaactggaacattcggaatgcagtccgaacgctcgagtcgaaaggttgtaccgggcg
cacaaagcctattggcaggcggtaaaagacggcaatatcgaagccgcatacgcaggcatc
tcggatatcgtggtcctggcagcttggcggcaggatgcggaagacttcaacgaagcctat
tgcagccatgtacgccgcaaaatgaacataccggaacatcaggcctatttcgccggagaa
ccgattatgatcagacagaacgactacgcgcttgaactgttcaacggcgacatcggattg
attatggaagatgtcggacggcagggcagccttgccgcctattttgccgatgcggacgga
tttaaaaaggtagcggtaagctgcctgcccgatttcgaacccgcattcgccatgaccgtc
cacaaaagccaaggttcggaatatcgggaagtctggctgctgccgccttccgccgcacct
tcggacgaaggggacgatgcattgtccggattgagtaaggagctgttatataccgccatt
acccgcgcgagggagaagttcgtattcttcggcggagaagaaaccttccggcaagctgcc
gccactgtcaaaacgcgtcagacggcattgggcagtatgctcgagcgggtattttcacaa
gaataa

DBGET integrated database retrieval system