KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1445Help
Entry
NMV_1445          CDS       T01928                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00020  Citrate cycle (TCA cycle)
nmt00190  Oxidative phosphorylation
nmt00650  Butanoate metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
Module
nmt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMV_1445 (sdhD)
   00650 Butanoate metabolism
    NMV_1445 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMV_1445 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: CAX50276
Position
complement(1412105..1412446)
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWAMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSIKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggcgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtctggctg
gtcggctgcttggtgtattcaattaaagtaatttgggggtaa

DBGET integrated database retrieval system