KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1526Help
Entry
NMV_1526          CDS       T01928                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK; 4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMV_1526 (ispE)
Enzymes [BR:nmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NMV_1526 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1491716..1492561)
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGKREDGYHNIESIFCLIDLQDTVYLKLRDDGKIILHN
PVDGMPQEVDLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCGLTQRQLIDSGAALGADVPFFIFGKNAFARGIGDRLDEMDIPKQWYVIVKPPVHVST
AKIFTHESLTRDSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRNSAYNIYRQVSDLYEAYLAEGLSKHPWLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattactggaaagcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaactaagggacgacggcaaaatcatcctgcacaat
ccggttgatggcatgccgcaggaagtagatttaagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgcggtctgacgcagcggcagctcattgattcgggcgcggctctgggggcggac
gtaccgttttttattttcggcaaaaatgcgtttgcgcggggtataggcgacaggctggac
gaaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaagcttgacacgggattctgcctcaagcataatgccgact
ttccaaaacctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgagttgtcccgatatggatttgccttaatgacaggttct
ggtgcgtgtgtattcacggcgtgtcaagataggaatagcgcatacaatatataccgacaa
gtttcagatttgtacgaggcatatttggcagagggtctttcaaaacatccttggttgtcc
gtataa

DBGET integrated database retrieval system