KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1606Help
Entry
NMV_1606          CDS       T01928                                 

Gene name
pgm
Definition
phosphoglucomutase (glucose phosphomutase; PGM) (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMV_1606 (pgm)
   00030 Pentose phosphate pathway
    NMV_1606 (pgm)
   00051 Fructose and mannose metabolism
    NMV_1606 (pgm)
   00052 Galactose metabolism
    NMV_1606 (pgm)
   00500 Starch and sucrose metabolism
    NMV_1606 (pgm)
   00520 Amino sugar and nucleotide sugar metabolism
    NMV_1606 (pgm)
  Nucleotide metabolism
   00230 Purine metabolism
    NMV_1606 (pgm)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMV_1606 (pgm)
Enzymes [BR:nmt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMV_1606 (pgm)
    5.4.2.8  phosphomannomutase
     NMV_1606 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555786..1557168
Genome map
AA seq 460 aa AA seqDB search
MANIARDIFKAYDIRGIVGKTLTDDAAYLIGRAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIDVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIIEKDGFVAADKQGNVTEKDISGEYHNHIVGHIKLKRPMKIAIDAGNGV
GGAFAGKLYKGLGNEVTELFCDVDGTFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPGAKVIFDVKSTRLLAPWIKEHGGEAIM
EKTGHSFIKSTMKKTGALVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVINELAAKAEFEGATEIITIDGRRVEFPDGFGLMRA
SNTTPILVLRFEADTQEAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgcccgcgacatcttcaaagcctacgacatccgaggcattgtcggcaaa
accctgactgacgatgccgcctatctcatcggcagggccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcgacgtcctcaacgtcggtatggtc
gccacgcccatgctctattttgccgctatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcccgattacaatggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagccattattgaaaaagacggttttgttgcc
gccgacaaacaaggcaacgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggccacatcaaactcaaacgccccatgaaaatcgccatcgacgcaggcaacggcgta
ggcggcgcattcgcaggcaaactctacaaaggcttgggcaatgaagttaccgaacttttc
tgcgacgtggacggcactttccccaaccaccatcccgacccatccaaaccgaaaaacctg
caagatttgattgccgcgctgaaaaacggcgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggcgtggttaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcgcaagacgtgttgagccgcaaccccggcgcgaaagtcatcttcgac
gtgaagtccacccgcctgcttgcgccttggattaaagaacacggcggcgaagccataatg
gaaaaaaccggccacagcttcatcaaatcgaccatgaaaaaaaccggcgcactcgtcgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggattcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcaacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtcggcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagaagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system