KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1771Help
Entry
NMV_1771          CDS       T01928                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase; UDPGP; alpha-D-glucosyl-1-phosphate uridylyltransferase; uridine diphosphoglucose pyrophosphorylase) (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NMV_1771 (galU)
   00052 Galactose metabolism
    NMV_1771 (galU)
   00500 Starch and sucrose metabolism
    NMV_1771 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NMV_1771 (galU)
Enzymes [BR:nmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NMV_1771 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1703072..1703941
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEASQTGSYGIVETEQLK
QFQRIIGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTGLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatacggaaagccgttttccccgtcgcagggatgggaacacgcttcctgccc
gccaccaaggcaagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggagacgaaccctttgccgttatccttgccgacgacctgattgatgcccccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggcaacagcattttgggcgta
gaaaccgttgaagcatcacaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattatcggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgtcgtcggacgctacatccttaccccgcgcattttcgacttactgaccggactg
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctggcgcacccctttgaaggcacgcgctacgactgcggcagcaaactgggc
tacctcgaagccaccgtcgcctacggtttaaaacaccccgaaaccggcgaacccttccgc
cgccttttggaaaaataccgtaccgaataa

DBGET integrated database retrieval system