KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1875Help
Entry
NMV_1875          CDS       T01928                                 

Gene name
dsbC
Definition
thiol:disulfide interchange lipoprotein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1800476..1801258
Genome map
AA seq 260 aa AA seqDB search
MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAAKAESAGKSVAASLKARLEKTYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
RSQSGYSPMPQLEEIIRKNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttgaccccctttaccgtcctcccgctgctggcttgc
gggcaaacgcccgtttccaatgccaacgccgaacccgccgccaaagccgagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgttagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
aggcagattatctacaccgatgccgaaggcggctatatgttcgtcggcgaactcatcaac
atcgacacgcgcaaaaacctgaccgaagaacgcgccgccgatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccccgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system