KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1879Help
Entry
NMV_1879          CDS       T01928                                 

Definition
putative alcohol dehydrogenase (ADH-HT) (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMV_1879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMV_1879
  Lipid metabolism
   00071 Fatty acid degradation
    NMV_1879
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMV_1879
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMV_1879
   00626 Naphthalene degradation
    NMV_1879
Enzymes [BR:nmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMV_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1805658..1806698
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVNADYAVKVPDGLDPAQASSITCAGVTCYKAVKVSGVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDEKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVDCVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRTLDEAPAIFQEMREGKITGRMVIDMKKECGCSHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaacgcgag
gttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtcaatgcggactacgcggtcaaagtccccgacggactcgaccccgcc
caagcgtccagcatcacttgcgccggcgttacctgctacaaagccgtgaaagtttccggc
gtgcgcccgggacaatggattgcgatttacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgatgaaaaa
ctggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gccgccgcattcaactctgccgtggattgcgtccgcgcgggcggacgtgtggttgccgtc
ggactgccgccggaatcgatggatttgtctatcccgcgtttggttttggacggcatcgaa
gtggtcggctcgctggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtactttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggtcgtatggtgatcgatatgaaaaaagaatgc
ggctgcagtcatcaccactga

DBGET integrated database retrieval system