KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1879Help
Entry
NMV_1879          CDS       T01928                                 

Definition
(GenBank) putative alcohol dehydrogenase (ADH-HT)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00010  Glycolysis / Gluconeogenesis
nmt00071  Fatty acid degradation
nmt00350  Tyrosine metabolism
nmt00625  Chloroalkane and chloroalkene degradation
nmt00626  Naphthalene degradation
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMV_1879
  Lipid metabolism
   00071 Fatty acid degradation
    NMV_1879
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMV_1879
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMV_1879
   00626 Naphthalene degradation
    NMV_1879
Enzymes [BR:nmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMV_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Methyltransf_25 TrkA_N DUF2237 CoA_binding Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: CAX50680
Position
1805658..1806698
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVNADYAVKVPDGLDPAQASSITCAGVTCYKAVKVSGVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDEKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVDCVRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRTLDEAPAIFQEMREGKITGRMVIDMKKECGCSHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaacgcgag
gttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtcaatgcggactacgcggtcaaagtccccgacggactcgaccccgcc
caagcgtccagcatcacttgcgccggcgttacctgctacaaagccgtgaaagtttccggc
gtgcgcccgggacaatggattgcgatttacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgatgaaaaa
ctggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gccgccgcattcaactctgccgtggattgcgtccgcgcgggcggacgtgtggttgccgtc
ggactgccgccggaatcgatggatttgtctatcccgcgtttggttttggacggcatcgaa
gtggtcggctcgctggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtactttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggtcgtatggtgatcgatatgaaaaaagaatgc
ggctgcagtcatcaccactga

DBGET integrated database retrieval system