KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_1897Help
Entry
NMV_1897          CDS       T01928                                 

Gene name
nagZ
Definition
beta-hexosaminidase (N-acetyl-beta-glucosaminidase; beta-N-acetylhexosaminidase) (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nmt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826406..1827491
Genome map
AA seq 361 aa AA seqDB search
MTVPCIPRGPVMADIAAFRLTEEEKQRLLDPAVGGVILFRRNFQNIAQLKELTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMNVLGQIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHHNPEAVAHLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDRRSLSELEAADLAPFHIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGVGGLKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTADFQEAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgttccctgtattccgcgcggccccgtcatggccgacattgccgccttccgcctg
accgaagaggaaaagcaacgccttctcgatcccgccgtcggcggagtcatcctgttccgc
cgcaacttccaaaatatcgcacagctcaaagaactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggaagggtgcaacgtttcatcgaa
ggttttacccgcctgcccgcaatgaacgttttagggcaaatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccacaatcccgaagcggtcgcccacctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacgga
tttgtcgaaggagacagccatctggtcttgccggaagacaggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccacattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgatatcggattcaaaggcgtgattttctcggacgatttg
actatggagggcgcgtgcggtgtcggcggcctcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgttatgcagacggcggatttccaagaggcgcaagcc
tttgttgccggccttgcctcgccgcaggatacagcgggcggcgtaaaagtcggcgaagcc
ttttaa

DBGET integrated database retrieval system