KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_2073Help
Entry
NMV_2073          CDS       T01928                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (protein-beta-aspartate methyltransferase; PIMT; protein L-isoaspartyl methyltransferase; L-isoaspartyl protein carboxyl methyltransferase) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Brite
Enzymes [BR:nmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NMV_2073 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1994913..1995569)
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLASRVVSDDIDAEQQNRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMVVIVGRRPVQ
RALLITRRGDVFEEKVLFDTLVAHLDDKDADPFGGFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccttgggatgta
ttggattttgacgttttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gatttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacggtcataagatg
ctggagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgcttttggcaaaattggctagt
cgtgtggtgtcggacgacatcgatgccgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgtctttggaaaacattgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaggccggtgcaa
cgcgcgcttttgattacgcgcaggggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggttttcagttttga

DBGET integrated database retrieval system