KEGG   Neisseria meningitidis 8013 (serogroup C): NMV_2075Help
Entry
NMV_2075          CDS       T01928                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM; triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmt  Neisseria meningitidis 8013 (serogroup C)
Pathway
nmt00010  Glycolysis / Gluconeogenesis
nmt00051  Fructose and mannose metabolism
nmt00562  Inositol phosphate metabolism
nmt01100  Metabolic pathways
nmt01110  Biosynthesis of secondary metabolites
nmt01120  Microbial metabolism in diverse environments
nmt01130  Biosynthesis of antibiotics
nmt01200  Carbon metabolism
nmt01230  Biosynthesis of amino acids
Module
nmt_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMV_2075 (tpiA)
   00051 Fructose and mannose metabolism
    NMV_2075 (tpiA)
   00562 Inositol phosphate metabolism
    NMV_2075 (tpiA)
Enzymes [BR:nmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMV_2075 (tpiA)
Exosome [BR:nmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMV_2075 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMV_2075 (tpiA)
  Exosomal proteins of melanoma cells
   NMV_2075 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAX50843
Position
1996377..1997132
Genome map
AA seq 251 aa AA seqDB search
MWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAMQIVLNN
RILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQRRKMENV
LNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGTGKVATV
EQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGASLSYDS
FTAIISAAQNA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatcaaaaatgggtcatcggcaactggaaaatgaacggccggctccagaacaac
aattcgctcatgcaccgcttccgcatcctccccaccgccgaacgcgtcctcatcggactc
gccgccccgaccgtttacctgctgcaactgcacaacgccatgcaaatcgtcttaaacaac
cgcatcctcacctgcgcccaagacgtgagccgcttccccgacaacggcgcgtacaccggc
gaagtgtccgccgaaatgctcgccgacaccggcacagacatcgtcctcatcggacactcc
gaacgcagcctttatttcggcgaaaaaaacgaaatccaacgccgcaaaatggaaaacgtc
ctcaacgtcggactcatcccgttattgtgcgtcggcgaaagcctcgaagagcgcgaagcc
ggcaaagaacacgaagtcatcgcccatcagctttccatcctgcaagggctggataccaaa
aacatcgccgtcgcctacgaacccgtctgggcgatcggcaccggcaaagtcgccaccgtc
gaacagattgccgatatgcacgcattcatctacaaagaaatcttgtctttgtgcggaagc
gatgttaaaatccgcgtcctttacggcggaagtgtgaaagcggacaacgcggccgacatc
ttcgcagtaccttatgtggacggcgcactcgtcggcggcgcgtcattgtcgtacgactcc
tttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system