KEGG   Nitrosospira multiformis: Nmul_A0151Help
Entry
Nmul_A0151        CDS       T00302                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmu  Nitrosospira multiformis
Brite
Enzymes [BR:nmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Nmul_A0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_23 RrnaAD Methyltransf_11 Methyltransf_18 ACP_syn_III_C Methyltransf_32 Fibrillarin CMAS GidB
Motif
Other DBs
NCBI-ProteinID: ABB73460
JGI: NmulA0151
UniProt: Q2YCR1
Position
complement(160502..161212)
Genome map
AA seq 236 aa AA seqDB search
MNWQFATAFGALMYFGCVIPLSAAEYEALRQKMVREVIAASGNSPPGASVVAAMEKVERH
RFVPAWLSIFAYRNHPLPIGHGQTISQPLIVARMTELLKLKKDDKVLEIGTGSGYQAAVL
AEIAKTVYTIEIIEPLGNEAAGRLQSLGYDNVKTRIGDGYYGWPEAAPFDAILVTAAASH
VPPPLLKQLKPGGRMVVPLGAPFMTQYLMLVEKQPDGSVTTHQIVPVRFVPLRGGH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaactggcagtttgcgaccgctttcggcgcattgatgtatttcggttgtgttattccg
ctgtcagctgcggaatatgaggccttgcgccagaaaatggtgagggaagtgattgccgca
tccggtaattcccctcccggagcaagtgttgtagcggcaatggaaaaagtggagcgccat
cgcttcgtacctgcctggctctccatatttgcgtatcgcaatcatccactcccgatcggc
catggacagacgatctcgcaacccctcatcgttgcgcggatgaccgagctgctgaagctc
aagaaagacgacaaggttcttgaaatcgggacgggctcgggttatcaggctgctgtcctg
gcggagatcgcgaaaacggtttatacaattgaaatcatcgaacccctgggaaacgaggct
gcaggaagattgcaatcgctgggctacgacaatgtgaagacccgcataggggacggttat
tacggctggccggaagcggccccattcgacgccatcctggtaacggccgccgccagtcat
gtgccccctcctctgctcaagcaactgaagcccggcggacgtatggtggtgccgttgggc
gcacctttcatgacccagtacctgatgctggtggagaaacagccggacggttcagttacc
acccatcaaattgtcccggttcggttcgttcctctcagaggcggacattaa

DBGET integrated database retrieval system