KEGG   Nitrosospira multiformis: Nmul_A0267Help
Entry
Nmul_A0267        CDS       T00302                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00521  Streptomycin biosynthesis
nmu00523  Polyketide sugar unit biosynthesis
nmu01130  Biosynthesis of antibiotics
Module
nmu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Nmul_A0267
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmul_A0267
Enzymes [BR:nmu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Nmul_A0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABB73575
JGI: NmulA0267
UniProt: Q2YCE6
Position
288990..289541
Genome map
AA seq 183 aa AA seqDB search
MKVIATSIPEVMIIEPKVFGDSRGFFFESFNQENFRQATGLDVRFVQDNHSRSVKGVLRG
LHYQVRRPQGKLVRVVRGAVFDVAVDIRRSSPTFGHWVGVELTEDNYRQLWLPPGFAHGF
YVLSDIADFLYKTTEYYFSDFDRSILWNDPGIAIGWPIEAGVSPVVSSKDEKAARLVHAE
VFE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttatcgccacctctatcccggaggtcatgataatcgagcctaaagtattcgga
gatagtcgcggatttttcttcgaaagcttcaatcaggaaaatttccggcaggcgaccgga
cttgacgtgcggtttgtacaggataatcatagccgctctgtcaagggtgtactgcgtggc
ctgcactatcaggttcgtcggccgcagggaaagctggtacgtgtcgtgcggggagcagta
ttcgacgtagcagtggatattcgcagatcatcccctacttttggccattgggtcggggtc
gaattgactgaagacaattaccgccagttgtggttgccgcccggattcgcgcatggattc
tatgtcctcagtgacattgcagatttcttatataaaaccaccgagtactatttttctgat
tttgatcgcagtattctgtggaacgacccgggaattgccatcggatggcccatcgaggca
ggtgtaagccctgtcgtttccagcaaagatgaaaaggcggcgagactggttcatgccgag
gtgttcgaatga

DBGET integrated database retrieval system