KEGG   Nitrosospira multiformis: Nmul_A0484Help
Entry
Nmul_A0484        CDS       T00302                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
nmu  Nitrosospira multiformis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmul_A0484
Enzymes [BR:nmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Nmul_A0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
542214..543119
Genome map
AA seq 301 aa AA seqDB search
MSPSSIPPVEIFRLSHRPLVMGVVNITPDSFSDGGLFASTDHALNHAFHLMEEGADLLDV
GGESTRPGSTPVFVEEELRRILPVVEELANQNVRVSVDTSKPEVMRAAIAAGAVMINDVR
ALQMPGALEAVAEGGVMACLMHMQGEPANMQVNPQYDDVVQDVKVFLKRRVEAAQAAGIP
RERLVVDPGFGFGKNQVHNIELLRHLDQFIDLGVPVLVGLSRKSMLGKITGSDINNRIHA
SIAAALIAAMKGAAILRVHDVRATRDALAVYNAVYDRGSARENASSLTSRWKPSVEFNSF
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaccatcttctattccgcctgtagaaattttcaggctctctcatcgccctcttgtg
atgggcgttgtcaatataactcctgactccttttcggatggcggcttgttcgcttcaacc
gaccatgccttgaaccatgctttccatttgatggaagaaggggcggatctgctggacgtc
ggcggtgaatcaacgcgccctggcagcaccccggtttttgtcgaagaggaattacgtcgg
attctcccggtagtggaagaactggcaaatcagaatgtgcgggtttcggtcgacacttcc
aaacccgaagtcatgcgcgctgccatcgccgcgggggccgtgatgattaacgatgtgagg
gcactccagatgccgggtgcgctggaggcggtcgcagaaggaggtgtgatggcttgcctc
atgcatatgcagggtgaacccgctaatatgcaggtcaatccccaatatgatgatgtagtg
caggatgtcaaggtttttctgaagcggcgggtggaggctgcccaagccgcaggtattccg
cgggagcggctggtagtcgatccgggctttggttttggtaaaaaccaggttcataatatc
gagctattacggcatctcgatcagtttatcgatcttggagtaccggtactggtaggtctc
tcgcgcaaatcgatgctgggaaaaatcacgggcagtgacataaataaccggattcatgcc
agcatagcggcagcgctgatcgcggctatgaagggtgcggccatcctccgtgtgcatgac
gtccgggcaacccgggatgcgctcgctgtttacaatgcggtttacgaccggggctctgca
cgggagaatgcatcatcgctcacttcacggtggaaaccctcagttgaattcaattcattt
cgataa

DBGET integrated database retrieval system