KEGG   Nitrosospira multiformis: Nmul_A0485Help
Entry
Nmul_A0485        CDS       T00302                                 

Gene name
glmM
Definition
phosphoglucosamine mutase
Orthology
K03431  
phosphoglucosamine mutase [EC:5.4.2.10]
Organism
nmu  Nitrosospira multiformis
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
543137..544528
Genome map
AA seq 463 aa AA seqDB search
MTRKYFGTDGIRGRVGEAPITPEFVIHLGYSAGKVLTSSDWHLSKGERPAVLIGKDTRIS
GYMLESALQAGLSAAGVDVLLSGPMPTPAVAYLTRALRLQAGIVISASHNPFEDNGIKFF
SALGAKLPDATEQEIEAGLNAPLKAMPSAQLGKARRVNDARGRYIEFCKSTFPNHLDLRG
LRVVVDCAHGATYQIAGPVLHELGAEVVAIGIHPDGLNINHECGATHGAALQEAVRHHRA
DIGVALDGDGDRVIMTDGEGMLYDGDQLIYLVAKHRKQNGLLKGGVAGTLMTNLAIENGL
KKLDIPFARANVGDRYVLELLQIKNWQLGGEGSGHIICLDKHTTGDGIISALQVLYAMRD
SGKTLTELASDVTLYPQQLINVRVPKGFDAHNSLAIKTAQAEAERDLDTTGRVLLRASGT
EPLIRVMVEGESGQKVKHWAEKIAEVVRNAAAGERSVEKALPN
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaaaatattttggaactgacggcatacgcggacgcgtaggtgaagcgcctatc
acgcccgaattcgtgatacatctgggttattctgcgggcaaggttctgacctcctcggat
tggcatctttcaaaaggagagcgcccggcagtattgatcggcaaggatacacgcatatca
ggctatatgctggaatcagccttgcaggcggggctttccgcagccggagtggatgttctg
ctttcggggcctatgcccactcctgcggttgcctatctcacccgggccctgcgtttgcag
gcgggcatcgtcatttcggcttcccacaatcctttcgaggataacggcatcaagtttttt
tctgccctcggcgccaaattacccgatgcgaccgaacaggagattgaagcgggattgaat
gcgcctctcaaggcaatgccgtcggcgcagctcggaaaagcgcggcgcgttaatgacgcc
agaggacgctatatcgagttctgcaaaagcacttttccaaatcacctcgatctgcgggga
ctgcgggtcgtggtcgattgcgcccatggcgccacttatcagattgccggtcccgtattg
cacgaattgggcgccgaagtagttgcgattggaatccatcccgatggtctcaatatcaat
cacgagtgtggggcaacgcatggagcggccctgcaggaagctgtccggcaccatcgggca
gatatcggagtggcattggatggggatggtgatcgcgtaatcatgaccgatggcgagggc
atgctttacgacggcgaccagttgatctacctcgtcgcgaaacatcgaaaacaaaacggg
ctgctcaaggggggggtggcggggacgctcatgacgaatctggcgattgaaaacgggtta
aagaaactggatattccttttgcgcgcgcgaatgtcggcgatcgctatgtgctggaactg
ctgcagataaaaaactggcagctgggcggcgaaggttccggccatattatctgcctcgac
aaacatactaccggtgacggaatcatttcggcactacaggtactctacgcgatgcgtgat
tccggcaagaccttgaccgagctcgcatcagacgtgacgctctatccgcaacaactcatc
aatgtcagggtacccaagggatttgatgcgcacaacagtcttgccatcaaaaccgctcaa
gcagaggccgaacgcgatctcgatactacgggccgggtgcttctgcgtgcttcgggtacg
gaacccttgataagagtaatggtagagggcgagtccgggcagaaagtcaagcactgggcg
gagaaaatagcggaagttgtgcgaaatgcggcggcaggcgagagatcggttgaaaaggcg
ctgccgaactga

DBGET integrated database retrieval system