KEGG   Nitrosospira multiformis: Nmul_A0588Help
Entry
Nmul_A0588        CDS       T00302                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00900  Terpenoid backbone biosynthesis
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nmul_A0588
Enzymes [BR:nmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Nmul_A0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABB73896
JGI: NmulA0588
UniProt: Q2YBH5
Position
672751..673635
Genome map
AA seq 294 aa AA seqDB search
MNGILSTTEVDSQAELSCPAPAKLNLFLHVVGRREDGYHLLQTVFRLVDFADQLHFGLRA
DGVIKLHTPTPGVPEEQDLCVRAAKLLQRESGTPWGANIFLEKRIPMGGGLGGGSSDAAT
TLLALNRLWKLGWRRNQLLKLAPELGADVPVFVFSENAFAEGIGEKLLPIALPPAWYLIL
TPPVHVSTAKVFSSKELTRNTIPIKIPPFSTEQGHNDLEPVVCASYPEVARHLEWLRQLE
GARMAAMTGSGACVFAEFATESGARSALGKIPYGMKGFVAQGLDRHPLHDFAEQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaatactgtcaacgactgaagtggattcgcaggcggaactgagctgccctgcg
cctgccaaactcaatctgttcctgcatgtggtgggacggagggaggatgggtaccatctt
ctgcaaaccgttttccgcctggtggatttcgccgaccagctccatttcgggctgcgggcg
gacggtgtgatcaagctgcatacgcccactccgggggtgccggaagagcaggatttgtgc
gtgcgcgcagcaaaactgctgcaacgggaaagcggtactccctggggggccaatatcttt
ctggaaaagcgcatcccgatgggtggtggcctgggaggcggcagttcggatgcagccacg
acattgcttgcgctcaaccgcttgtggaagctgggctggcgccggaatcaacttttgaaa
ctggccccggaactgggtgcggatgttcccgtattcgttttcagtgaaaatgcctttgct
gagggcatcggcgaaaaactcctgccgattgcgttacccccggcatggtatctgatactc
acaccgcccgtgcatgtctcaacggcaaaggttttttcaagtaaggaattgacacgaaac
acgattccgatcaaaataccgcccttttccaccgagcaagggcataatgatctcgagccg
gtggtgtgtgcttcataccccgaggtagcacgccacctcgagtggctgcggcagctcgaa
ggtgcaaggatggcggccatgacgggttccggcgcgtgcgtttttgccgagtttgcgacc
gaatccggggccagaagcgcactggggaagattccatacggtatgaagggttttgtggcg
cagggacttgatcgccatcccttgcatgattttgcagaacaataa

DBGET integrated database retrieval system