KEGG   Nitrosospira multiformis: Nmul_A0648Help
Entry
Nmul_A0648        CDS       T00302                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nmu  Nitrosospira multiformis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nmul_A0648
   00052 Galactose metabolism
    Nmul_A0648
   00500 Starch and sucrose metabolism
    Nmul_A0648
   00520 Amino sugar and nucleotide sugar metabolism
    Nmul_A0648
Enzymes [BR:nmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nmul_A0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
747163..748047
Genome map
AA seq 294 aa AA seqDB search
MPKIRKAVFPVAGMGTRFLPATKANPKEMMPVVDKPLIQYAVEEAIAAGITEMIFITGRH
KRAIEDHFDKAYEIENELEARGKNETLEMLRSILPKNIHCIYIRQSEALGLGHAILCARP
AVGNDPFAVLLADDLLVGDEPIMRQLGKVYEENGCSILAVQNVEPEDTLNYGIVKCGPGM
NGLHPITGIVEKPAPENAPSRLGVVGRYILTPKIFEHLERVQPGAGGEIQLTDGIASLLR
EERALAYEFHGTRYDCGSKIGYLKATIALALQHPEVGREFAAYLDARCSGHTSV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaatacgtaaagcagtttttccggtggcaggaatgggcacccgttttctccct
gctacgaaggcaaatcccaaggaaatgatgcctgttgtagataaaccgttgattcagtac
gcggttgaggaggcgatcgcagcgggtatcacggagatgattttcataacgggccgtcac
aagcgcgccattgaagaccatttcgacaaagcgtacgaaatagaaaacgagttggaggcc
cgtggcaaaaatgaaacgctggaaatgttgcgcagcatcctgcccaaaaacattcattgc
atttacatccgccaatcggaagcactcgggttagggcacgctatcctttgcgcgcgtccc
gcggtaggaaatgatccttttgccgtgctgctggcagatgacctgctcgtaggcgatgag
ccgatcatgcggcagttgggcaaggtgtacgaggagaacggctgctccatactggccgta
cagaatgtcgagcctgaagatactctcaattatggcattgtgaaatgcgggcccgggatg
aacggcttgcatcccattaccggcatcgtggaaaaacctgccccggagaatgctccctct
agattgggcgtcgtcggacgttatattttgaccccgaaaatcttcgagcacctggaaagg
gttcaacctggggccggaggggaaattcagctgaccgatggaatcgcttcgcttttgcgg
gaagagcgggcgctggcctatgaattccacggaacgcgttacgattgcgggagcaagata
ggatacctcaaggcaacgattgcgctggcgctccagcatccggaggtcgggcgtgagttt
gcggcgtatctcgacgccagatgcagtgggcataccagcgtctag

DBGET integrated database retrieval system