KEGG   Nitrosospira multiformis: Nmul_A0717Help
Entry
Nmul_A0717        CDS       T00302                                 

Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00500  Starch and sucrose metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
Module
nmu_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nmul_A0717
Enzymes [BR:nmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Nmul_A0717
Exosome [BR:nmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nmul_A0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ABB74024
JGI: NmulA0717
UniProt: Q2YB47
Position
complement(829681..831921)
Genome map
AA seq 746 aa AA seqDB search
MRAYPTIQRPSIKRDPRLHALLAGRLHDPFSFLGPHVEHGHWVVRAFHPHAASIWINTDD
GFESMTRAHPAGVFEWWGLIPLPLPYQLRIEEASFEAPAHVYDIYDAYAFPPQVSEHDLY
LFNEGRLHQAYRMLGSHLVEMEGVAGVRFSVWAPNAERVSVVGSFNRWDGRIHPMVSHGA
SGVWELFIPGVPTDSFYKYEIRNRDTGAILLKTDPYARHYEVRPGTAARAPSASRMTWGD
ARWMAQRAVWDWLATPLNIYEVHAGSWKRHANGSFYSYRELADHLLPYVREMGYTHIELL
PISEHPLDESWGYQTTGYFAATSRYGTSDDLKFFINACHQEGIGVILDWVPAHFPQDAFA
LARFDGSALYEHEDPRMGLHQDWGTHIFNYGRNEVKSFLLSSAHYWLSEFHLDGLRVDAV
ASMLYLDYSRLPGEWLPNRYGGRENLEAIDFLRELNIMVHQEFPGALTLAEESTAWPGVS
RPTYVGGLGFSMKWNMGWMNDTLVYMRNDPVYRRFHHEQLTFGQLYAYSENFVLPFSHDE
VVHGKGSLLGKMPGDAWQQFANLRLLFTYQMTYPGKKLNFMGNEFAQGREWNSSRELDWY
QLGDGWHEGVKMAARDLNQLYSAVAALHQRDFEPEGFSWVDCHDADNSVISYLRFARNGS
FALVVLNFTPVPRYRYRIGVPTSGSYQEIFNSDSRYYGGSDLGNMGSIRTTGQPSMERMD
SIVITLPPLAGLIFVHTDLPAINTDG
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcgtatcctacaatacagcgcccctccatcaagcgagaccctaggttgcatgcc
ctgctggctggacgcctgcacgatcctttcagtttccttggcccccatgtggaacatgga
cattgggtggtgcgcgccttccatccccatgctgcaagcatctggatcaacacggatgac
ggtttcgaaagcatgacaagagcccatcctgccggagtttttgaatggtggggacttata
cccctgcctctgccttatcagctacgcatcgaagaggcttccttcgaagcacccgcacat
gtgtatgatatttatgacgcctatgcgttccctccacaagtttcggaacatgacctgtat
ctgttcaacgaaggccgcttgcatcaggcttacaggatgctcggttctcatttggtggaa
atggaaggggttgccggagttcgtttttccgtttgggcaccgaatgcggagcgcgtcagt
gtggtcggaagctttaaccgctgggatggacgtatccatcccatggtctcccacggcgcg
agcggagtatgggaattgtttatccccggcgtgccgacggattcattttataaatatgaa
atccggaatcgggataccggcgcgatccttctcaaaacggatccttatgcgcgccattat
gaagtacgtcccggcactgctgcccgtgccccatccgccagcaggatgacatggggcgac
gcgcgctggatggctcagcgcgcagtatgggattggcttgccaccccgctcaatatttat
gaagttcatgccgggtcatggaaacggcacgcgaacggaagtttttattcataccgggaa
cttgccgatcacctgctcccgtatgtgcgggaaatgggatacacgcatatcgagttgctc
cctatttcggagcatcccctcgatgaatcctggggttatcagacgacgggttattttgcc
gcaaccagtcgctacggcacatcggacgacctgaaatttttcatcaacgcctgtcatcag
gagggaatcggtgtaatcctggactgggtccccgcacattttccgcaggatgctttcgcc
ctggcccgattcgatgggagtgccctatatgaacatgaggatccacgcatgggactgcat
caggactggggcacgcacattttcaactacggacgcaatgaggtgaaatcgtttctcctt
tccagcgcccactactggctatcggaatttcatcttgacgggctgcgtgtcgatgctgtc
gcttccatgctctatctcgactattcgcgacttccgggtgaatggctgcccaacagatat
ggaggcagggagaatctggaagccatcgattttctgcgtgaactgaatatcatggtgcat
caggaatttccgggggcgctgacacttgccgaggaatccactgcatggccgggtgtatcc
cgtccgacttatgtcggcgggctgggtttttccatgaagtggaacatgggctggatgaac
gacactctggtgtatatgcgcaatgatcccgtctaccggcgtttccatcatgagcagttg
acgttcgggcagttatacgcatacagcgaaaactttgtgctgccgttctcccatgatgaa
gtggttcacggcaaaggttcgcttctgggcaagatgcctggagatgcatggcaacaattc
gccaacctgcgcctgctgtttacctatcagatgacatatcccgggaaaaaactcaacttc
atggggaatgaatttgcccaggggcgtgagtggaattcatcgcgcgaactcgactggtat
cagttaggcgatggctggcatgagggagtaaaaatggcagcgcgagacctcaaccaactg
tacagtgccgtcgccgcactgcatcaacgtgatttcgagccggaaggcttttcgtgggtg
gattgtcacgacgcggataactctgtgatcagttatctgcgctttgcacgaaacggttcg
tttgctctggtggtactcaattttacgccggtgccacgctaccgttaccgcatcggggtg
cccacatcgggaagctatcaggaaatcttcaatagcgattctcgttactatgggggcagc
gatctcggtaacatgggaagtatccgcaccaccggccagccttccatggaacggatggat
tcaattgttatcaccctgccgccgcttgccgggctcattttcgttcatactgatctgcct
gcaatcaacaccgacggataa

DBGET integrated database retrieval system