KEGG   Nitrosospira multiformis: Nmul_A0740Help
Entry
Nmul_A0740        CDS       T00302                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmul_A0740
   01230 Biosynthesis of amino acids
    Nmul_A0740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A0740
   00030 Pentose phosphate pathway
    Nmul_A0740
   00051 Fructose and mannose metabolism
    Nmul_A0740
   00052 Galactose metabolism
    Nmul_A0740
  Energy metabolism
   00680 Methane metabolism
    Nmul_A0740
Enzymes [BR:nmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Nmul_A0740
Protein phosphatases and associated proteins [BR:nmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Nmul_A0740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(861132..862391)
Genome map
AA seq 419 aa AA seqDB search
MAAKNAFYAQSGGVTAVINASAAGVIEAARKQSGKIGRIYAGRNGIIGALTEDLIDTGQE
SDAAISALRYTPSGAFGSCRYKLKSLEQNRREYERLIEVFKAHDIGYFFYNGGGDSADTC
LKVSQLSGTLGYPIQAIHVPKTVDNDLPITDCCPGFGSVAKYIAVSTLEASFDVASMSAT
STKVFVLEVMGRHAGWIAAAGGLASSPEREIPVVILFPEISFDKQKFLAKVDSCVKKFGY
CSVVVSEGVKGDDGKFLSDQGVRDAFGHAQLGGVAPVVASMVKEGLGLKYHWGVADYLQR
AARHIASKTDVEQAYAMGQAAVEFAVQGHNSVMPTIERISARPYQWKVGMAQLSQVANVE
KMMPENFITEDGFGITDLCREYLAPLIEGEDYPPYKDGLPDYVRLKNVAVPKKLSGFTL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaaaaatgctttttatgctcaatccggcggcgttacggccgtcatcaacgct
tccgcagccggggtaattgaagccgcccgcaagcaaagcggaaagataggcaggatctat
gcgggacgcaacgggatcatcggcgcgcttaccgaggatctgatcgatactggccaggaa
tccgatgccgcaatcagcgccttgcggtacacaccctccggagcattcggctcctgccgc
tacaaactgaaaagccttgaacagaaccggcgggaatatgaacgcctgatcgaagtattc
aaggctcatgacatcggctatttcttctacaacggcggcggcgattcagcggatacatgt
ctcaaggtatcacaactgtccggcacacttggctatcccattcaggccattcatgtgcca
aaaacggtggataacgaccttcccatcacggactgctgtcctggcttcggctccgtggcg
aagtacatcgccgtatccacgcttgaagccagcttcgatgtggcaagcatgtcagcaacg
tccacgaaggtgttcgtgctggaagtaatgggacggcacgccggctggatagcagccgcc
ggaggcctggcgtccagccctgagcgtgaaattcccgtcgtcattctcttccccgaaatc
agcttcgacaaacagaaattcctcgccaaagtggatagctgcgtcaagaaattcggctac
tgctcggtagtggtatcggaaggcgtaaaaggagatgacggcaaattcctctccgaccag
ggggtgcgcgatgcgttcggacatgcgcaattgggaggggtggcaccggtggtggcgagc
atggtgaaggagggactcggactcaaatatcactggggtgtggcggactatctgcaacgt
gccgcgcgtcacatcgcctccaaaaccgacgttgagcaagcatacgccatgggccaggct
gcggtggaattcgcggtccaggggcataactccgtgatgcctaccatagaacgtatttcc
gccaggccctaccagtggaaagtaggtatggctcagctgtcgcaagtcgccaatgtcgaa
aaaatgatgcctgagaactttatcaccgaggacgggtttggcattaccgacctgtgccgg
gaatatctggcgccccttatcgagggtgaagactatccaccctacaaggatgggctgccg
gactacgtacggttgaagaatgtggcggtcccgaaaaaattgagcggcttcacgctttga

DBGET integrated database retrieval system