KEGG   Nitrosospira multiformis: Nmul_A0856Help
Entry
Nmul_A0856        CDS       T00302                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmu  Nitrosospira multiformis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmul_A0856
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmul_A0856
  Amino acid metabolism
   00310 Lysine degradation
    Nmul_A0856
Enzymes [BR:nmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Nmul_A0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(973164..974549)
Genome map
AA seq 461 aa AA seqDB search
MRVDIKVPALSESVAQATLLSWHKKEGEHVERDENLIDVETDKVVMELPAPATGTLAKII
KGDGATVTGGEVIAMIDTEAGATKDNTPAASTAAPSKSKVTESGAAPSAAEARPAKKEAE
AAPPSATAPASTTAAEVPGMMPAAQKLAAQENLAPEEIRALKGSGRDGRITKEDVAAYVE
QKRSTANIAPAPSPAVPQVPAAPPPSPAPPVSPAPESAPRMAEDKAEGKRSEKRVPMSRL
RARIAERLVQSQSTAAILTTFNEVNMQAIMDLRARYKDKFEKEHGVKLGLTSFFVKAAVA
ALKKFPIVNASVDGNDIVYHEYYDIGIAVSSARGLVVPIIRNADSLSQAEIERQVTDFGR
RAQDGKLTIEELTGGTFSITNGGVFGSMLSTPIINPPQSAILGIHATKERPVVENGQIVI
RPICYLALSYDHRIIDGREAVLSLVAMKEALEYPMSPLLES
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgatatcaaagttcccgcgttatccgaatcagtggcccaggcaacgctcctt
tcctggcacaaaaaggaaggggagcatgttgagcgtgacgaaaatctgatcgacgtcgaa
actgataaagtcgtgatggagttgccagctcccgctacgggaacactggcgaaaatcatc
aagggagacggagcaacggtgactggcggggaagtcatcgccatgatagataccgaagca
ggtgcgacaaaggataacactccggcagcttcaaccgcagccccaagcaagtccaaagta
accgaatccggagcagcgccttctgccgccgaagccaggccggccaaaaaagaggcagaa
gctgctccgccttccgcaactgccccggcttccacaaccgccgcggaagttccgggaatg
atgcctgccgcgcaaaaactggctgcgcaggaaaatctggcgccggaagaaattcgcgca
ctcaaaggcagcggtcgcgatggtcgcatcaccaaggaagacgtggcggcttatgtagaa
caaaaacgctcgacagccaatatcgcccccgcgccttctcctgcggttccgcaagttccg
gcagctccccctccctcccctgccccgcccgtttcacccgcccctgagtccgcgccccgg
atggctgaagacaaggctgagggaaaacgcagcgaaaaaagagtacccatgtcgcgcctg
cgtgcgcgcatcgcggaacgtctggtgcagtcgcaatccaccgccgccatccttaccaca
ttcaacgaagtcaacatgcaggcgatcatggatttgcgcgcccgctacaaggacaaattt
gaaaaggagcatggcgtcaaactcggtctcacctcattctttgtcaaagcggcggtggcg
gcgctcaaaaaatttcccatcgtcaacgcttcagtggacggcaacgatatcgtctatcac
gaatactatgatatcggcattgcggtgagcagtgcacgcgggctggtcgtccccattatt
cgcaatgcggattccttgtcccaggcggaaattgaaaggcaggtcaccgattttggccgc
cgcgcgcaggacggcaaactgaccatcgaggaattgaccggcggcactttctcgatcacc
aatggcggcgtcttcggttcgatgctttccacccccatcatcaatcccccgcagagcgcc
attcttggcattcacgcaaccaaggagcgcccggtggtcgaaaacggccaaatcgtgatt
cgtccgatatgctatctggcgctatcctatgaccatcgcatcatagacgggcgggaagcc
gtgctttccctggtagcgatgaaggaagcgctcgaatatcccatgagccccctgcttgag
agctga

DBGET integrated database retrieval system