KEGG   Nitrosospira multiformis: Nmul_A0903Help
Entry
Nmul_A0903        CDS       T00302                                 

Definition
hypothetical protein
Orthology
K14415  
tRNA-splicing ligase RtcB [EC:6.5.1.3]
Organism
nmu  Nitrosospira multiformis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1027803..1029230
Genome map
AA seq 475 aa AA seqDB search
MNLERLRQLQPCLWTLPRAPGEERAQVLLYGSAPLLVSMDDKVLEQIANVASLPGLVGAA
MTMPDAHWGYGFPIGGVAAFDAEQGGVISAGGVGFDISCGIRCLRSNLNLEDAVEHFPQL
GKALFRAIPAGVGEEGEIKLNPEQLDQVMHGGAHWAVQQGYGTPADLDYVEEQGRVAGAI
PENVSELAKKRQRGEMGTLGSGNHYLEVQVVDRIFDPGVALALGLHEGQILISIHCGSRG
LGHQIGTDYLVLLAKAASRSGIHLPDRELACAPVKSPEGQQYIGAMNAAINCALANRQIL
THLTRSVFTEIYPQAELETLFDVSHNTCKAETHQIDGESRLLYVHRKGATRAFGPGHPML
PERYRQVGQPVVIGGSMGTGSYILVGDSENPAFASSSHGAGRAMSRHQALARWKGRALVD
ELAQQGILIHTRSMRGVAEEAPGAYKDVDLVAEATEEAGLARRVAFLRPKVCVKG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggagcgcctacgtcaactgcaaccctgcctgtggacattgccgcgcgcaccg
ggcgaagaacgcgcgcaggtcctcctgtatggcagcgcgcccttgctcgtcagcatggac
gacaaggtactcgagcagatcgccaacgttgcttccctgccggggctggttggagcggca
atgaccatgccggatgcgcattggggatatggttttcccatagggggtgttgctgctttc
gatgctgagcaggggggggtgatttccgcaggcggggtcggcttcgatatttcgtgcggc
atacgctgtctgcgcagcaatctgaatctggaggatgcggtagagcattttccccagctc
ggaaaagccttgttccgcgctatccctgctggagtgggcgaggagggcgagatcaagctg
aacccggagcagctcgaccaggtgatgcacggcggtgcacactgggcggtacagcaaggc
tacggcactccagcagatctggattatgttgaagaacaggggcgggtagcaggagcgatc
ccggaaaacgtatccgaacttgccaaaaagcgccagcgcggcgagatgggcacgctcggc
tcaggcaatcattacctggaagtacaggtggtggaccgcatcttcgatcctggcgtcgcg
ctggcgcttggcctgcatgaaggacaaatcctgatttcgatacattgcggttcgcgtggg
ctggggcaccagatcggtaccgattatctggtgctattggcaaaagcagccagccgctcg
ggcattcatttacccgatcgtgaactcgcttgcgcgcctgtcaaatcccccgaaggccag
caatatatcggcgcgatgaatgctgcgatcaattgcgcgcttgccaaccggcaaatcctg
acgcatcttacgcgctccgtatttacggaaatttatccccaggccgagcttgaaaccttg
tttgatgtttcgcacaatacctgcaaggccgaaacccatcagatcgacggtgaatcgagg
ttgctgtatgtgcaccgcaagggcgctacacgcgcattcggcccgggccaccccatgctg
ccggaacgctaccgccaggtaggacaacccgtcgttatcggtggaagcatgggaacaggc
tcctacattctcgttggtgacagcgaaaatcccgccttcgcttcttcaagccacggtgca
ggccgggccatgagccggcaccaggcactcgcgcgatggaaaggacgtgcgctggtggac
gagttggcgcaacaaggtattctgatccatacccgctccatgcgaggtgtggcggaagaa
gccccgggcgcctataaggatgtcgatctggtggcggaggccacggaagaagccgggctc
gcccggcgcgtcgcgtttctccgacccaaagtctgcgttaagggttaa

DBGET integrated database retrieval system