KEGG   Nitrosospira multiformis: Nmul_A0903Help
Entry
Nmul_A0903        CDS       T00302                                 

Definition
(GenBank) Protein of unknown function UPF0027
  KO
K14415  tRNA-splicing ligase RtcB (3'-phosphate/5'-hydroxy nucleic acid ligase) [EC:6.5.1.8]
Organism
nmu  Nitrosospira multiformis
Brite
Enzymes [BR:nmu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.8  3'-phosphate/5'-hydroxy nucleic acid ligase
     Nmul_A0903
Transfer RNA biogenesis [BR:nmu03016]
 Eukaryotic Type
  tRNA spricing factors
   tRNA splicing ligases
    Nmul_A0903
 Prokaryotic Type
    Nmul_A0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RtcB
Motif
Other DBs
NCBI-ProteinID: ABB74206
JGI: NmulA0903
UniProt: Q2YAL5
Position
1027803..1029230
Genome map
AA seq 475 aa AA seqDB search
MNLERLRQLQPCLWTLPRAPGEERAQVLLYGSAPLLVSMDDKVLEQIANVASLPGLVGAA
MTMPDAHWGYGFPIGGVAAFDAEQGGVISAGGVGFDISCGIRCLRSNLNLEDAVEHFPQL
GKALFRAIPAGVGEEGEIKLNPEQLDQVMHGGAHWAVQQGYGTPADLDYVEEQGRVAGAI
PENVSELAKKRQRGEMGTLGSGNHYLEVQVVDRIFDPGVALALGLHEGQILISIHCGSRG
LGHQIGTDYLVLLAKAASRSGIHLPDRELACAPVKSPEGQQYIGAMNAAINCALANRQIL
THLTRSVFTEIYPQAELETLFDVSHNTCKAETHQIDGESRLLYVHRKGATRAFGPGHPML
PERYRQVGQPVVIGGSMGTGSYILVGDSENPAFASSSHGAGRAMSRHQALARWKGRALVD
ELAQQGILIHTRSMRGVAEEAPGAYKDVDLVAEATEEAGLARRVAFLRPKVCVKG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggagcgcctacgtcaactgcaaccctgcctgtggacattgccgcgcgcaccg
ggcgaagaacgcgcgcaggtcctcctgtatggcagcgcgcccttgctcgtcagcatggac
gacaaggtactcgagcagatcgccaacgttgcttccctgccggggctggttggagcggca
atgaccatgccggatgcgcattggggatatggttttcccatagggggtgttgctgctttc
gatgctgagcaggggggggtgatttccgcaggcggggtcggcttcgatatttcgtgcggc
atacgctgtctgcgcagcaatctgaatctggaggatgcggtagagcattttccccagctc
ggaaaagccttgttccgcgctatccctgctggagtgggcgaggagggcgagatcaagctg
aacccggagcagctcgaccaggtgatgcacggcggtgcacactgggcggtacagcaaggc
tacggcactccagcagatctggattatgttgaagaacaggggcgggtagcaggagcgatc
ccggaaaacgtatccgaacttgccaaaaagcgccagcgcggcgagatgggcacgctcggc
tcaggcaatcattacctggaagtacaggtggtggaccgcatcttcgatcctggcgtcgcg
ctggcgcttggcctgcatgaaggacaaatcctgatttcgatacattgcggttcgcgtggg
ctggggcaccagatcggtaccgattatctggtgctattggcaaaagcagccagccgctcg
ggcattcatttacccgatcgtgaactcgcttgcgcgcctgtcaaatcccccgaaggccag
caatatatcggcgcgatgaatgctgcgatcaattgcgcgcttgccaaccggcaaatcctg
acgcatcttacgcgctccgtatttacggaaatttatccccaggccgagcttgaaaccttg
tttgatgtttcgcacaatacctgcaaggccgaaacccatcagatcgacggtgaatcgagg
ttgctgtatgtgcaccgcaagggcgctacacgcgcattcggcccgggccaccccatgctg
ccggaacgctaccgccaggtaggacaacccgtcgttatcggtggaagcatgggaacaggc
tcctacattctcgttggtgacagcgaaaatcccgccttcgcttcttcaagccacggtgca
ggccgggccatgagccggcaccaggcactcgcgcgatggaaaggacgtgcgctggtggac
gagttggcgcaacaaggtattctgatccatacccgctccatgcgaggtgtggcggaagaa
gccccgggcgcctataaggatgtcgatctggtggcggaggccacggaagaagccgggctc
gcccggcgcgtcgcgtttctccgacccaaagtctgcgttaagggttaa

DBGET integrated database retrieval system