KEGG   Nitrosospira multiformis: Nmul_A1062Help
Entry
Nmul_A1062        CDS       T00302                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00010  Glycolysis / Gluconeogenesis
nmu00030  Pentose phosphate pathway
nmu00051  Fructose and mannose metabolism
nmu00052  Galactose metabolism
nmu00230  Purine metabolism
nmu00500  Starch and sucrose metabolism
nmu00520  Amino sugar and nucleotide sugar metabolism
nmu00521  Streptomycin biosynthesis
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1062
   00030 Pentose phosphate pathway
    Nmul_A1062
   00051 Fructose and mannose metabolism
    Nmul_A1062
   00052 Galactose metabolism
    Nmul_A1062
   00500 Starch and sucrose metabolism
    Nmul_A1062
   00520 Amino sugar and nucleotide sugar metabolism
    Nmul_A1062
  Nucleotide metabolism
   00230 Purine metabolism
    Nmul_A1062
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmul_A1062
Enzymes [BR:nmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nmul_A1062
    5.4.2.8  phosphomannomutase
     Nmul_A1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABB74365
JGI: NmulA1062
UniProt: Q2YA56
Position
1227030..1228439
Genome map
AA seq 469 aa AA seqDB search
MRQLPPEIFKAYDIRGVFGKTLTVEGAEAIGHAIGSEGRARGLAAITIGRDGRLSGPELV
QALARGLQGSGINVIDVGAVATPMLYYAAHELSGYSGVMVTGSHNPPEYNGFKMVLGGET
LAAESIQALRARIENENLAHGNGSYHKQDIAEGYLQRIAADIKLARPMKIIVDCGNGIPG
LYAPELYRRLGCDVTELFCEVDGTFPNHHPDPSVPGNLRDVVQALETTDAEIGLAFDGDG
DRVGVVTKNGTVIYPDRQLMLFAADVLSRNPGGRVIFDVKCTRNLAPWIMQHGGEPIMWK
TGHSFIKGKLKETGALLAGEMSGHIFFKERWYGFDDGLYAGARLLELLSSRMDIDAVFNS
IPDAVSTPELQIGLKEGENYAIIAQLQKTAHFARAERIITTDGMRVEYEDGFGLARSSNT
MPVIVLRFEADSEAALQRIQKDFCTAILKIKPDAELPHQLRGNLLSSTC
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaacttccaccagaaatcttcaaagcctatgacatccgaggtgttttcggaaaa
acactgacagttgaaggtgccgaagcgattggtcatgccatcggctccgaggggcgtgcg
cgcggacttgccgcaatcaccatagggcgcgacggcaggttgtcgggccccgagctggtg
caagccctggccaggggtttgcaaggaagtggtatcaacgtaatcgatgtcggtgctgtc
gcgaccccgatgctctactacgcggcgcatgaattgtccggttattccggcgtgatggta
accgggagccataacccgccggaatacaatggttttaaaatggtattggggggagaaaca
cttgctgcggaatcaatacaagccttgcgtgcgcgtatcgaaaatgaaaaccttgctcac
ggcaatggaagctaccacaagcaggatattgcggaaggatatcttcagcgcatagcagcg
gatataaagctggcgcggcccatgaagattatcgttgattgtggcaatgggatccccggt
ttatatgctccggaactgtaccgcaggcttggatgcgatgtaaccgagctgttttgcgag
gtcgacggcacttttcccaatcatcatccggatccctcggtacccgggaatcttcgggat
gtggtgcaggcgcttgaaacgactgatgccgagatagggctggcgttcgatggagatggt
gaccgcgtgggtgtggttaccaaaaatggaacggtcatttatccggatcggcaactgatg
ttgtttgcagccgatgtattatcgcggaatccgggtgggcgggtcattttcgatgtgaaa
tgtacgcgtaacctggcgccatggatcatgcagcacggaggcgagccgatcatgtggaaa
accgggcactctttcatcaaggggaaactgaaggaaaccggggcgctgctggcgggagag
atgagtgggcatatctttttcaaggagcgctggtatggcttcgacgacggactctatgcc
ggagcgcgtttgctggagctgctcagttccaggatggatatcgacgcggtattcaactcg
attccggatgcggtcagcacgccggagttgcagatcgggttgaaggaaggggaaaactac
gcgattatcgcgcagttgcagaaaacagcgcactttgcccgggctgaacgcatcattacc
accgatggaatgcgagtcgaatatgaagacggttttggtcttgcgcgttcatccaatacc
atgccggtaatcgtgctgcgtttcgaggcggatagcgaggcagctttgcagcgtattcag
aaggatttttgcacagcgatcctgaaaatcaaaccggatgcggaactgcctcatcagctg
aggggaaatctcctttcctccacatgctga

DBGET integrated database retrieval system