KEGG   Nitrosospira multiformis: Nmul_A1089Help
Entry
Nmul_A1089        CDS       T00302                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nmul_A1089
   01230 Biosynthesis of amino acids
    Nmul_A1089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1089
   00051 Fructose and mannose metabolism
    Nmul_A1089
   00562 Inositol phosphate metabolism
    Nmul_A1089
Enzymes [BR:nmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nmul_A1089
Exosome [BR:nmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nmul_A1089
  Exosomal proteins of bladder cancer cells
   Nmul_A1089
  Exosomal proteins of melanoma cells
   Nmul_A1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1256501..1257262
Genome map
AA seq 253 aa AA seqDB search
MAIRSKLVAGNWKMHGGTLQNRDLLNAVLSATADLSGVELAVCVPYPYLPQVQSILQGTN
VSWGAQNVSQHEKGAYTGEVSASMLLDFGCRYVIVGHSERRALYGEDSHTVALKFRAAQS
VGVIPILCVGETLEQREAGITEQVVAKQLEAVVKSAGINALGTAVLAYEPVWAIGTGKTA
SPAQAQEVHSFIRGRIAADAAEVAEGLKILYGGSVKAANAAELFAMPDIDGGLIGGASLV
AEEFIAIARAAKD
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctatacgttccaagctggttgcgggtaattggaaaatgcacggcggaacgctgcag
aaccgggatttgctgaatgcggttctttctgcgacggcagacctgagcggagtcgagttg
gcggtatgcgtaccttatccttacttaccccaagtgcaatcgattctgcaaggtacgaac
gtttcctggggcgcccagaacgtgagtcagcacgaaaaaggcgcctataccggtgaagtt
tcagcgtccatgctgctggattttggctgtcgctacgtgattgtcggtcactccgagcgg
cgggcgctgtatggtgaggatagccacactgtagcgctcaaattcagggcggcacaaagc
gtcggcgtgatacctattttatgtgtgggtgaaacgctcgagcagcgggaggccgggatt
acggagcaggttgtggcaaagcagttggaggcggtggtgaagtcggcgggaataaatgcc
ttgggtacggcggtgctggcttatgaaccggtatgggccatcggcaccggcaagaccgcg
agccctgctcaggctcaggaggtacattcgtttattcgcggcagaattgctgccgacgca
gcggaagtagccgagggattgaagattctttatggcggcagtgtcaaggcggccaacgcc
gctgagctcttcgccatgcccgacattgacggtggattgattggcggcgcttcgctcgtt
gccgaagaatttatcgcgattgcccgggccgcgaaagactaa

DBGET integrated database retrieval system