KEGG   Nitrosospira multiformis: Nmul_A1403Help
Entry
Nmul_A1403        CDS       T00302                                 

Definition
(GenBank) maltooligosyl trehalose hydrolase (EC:3.2.1.141)
  KO
K01236  
maltooligosyltrehalose trehalohydrolase [EC:3.2.1.141]
Organism
nmu  Nitrosospira multiformis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nmul_A1403
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.141  4-alpha-D-{(1->4)-alpha-D-glucano}trehalose trehalohydrolase
     Nmul_A1403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1605003..1606880)
Genome map
AA seq 625 aa AA seqDB search
MLTRLHDMPYGTQITDHGVRFRLWAPGCKQVGLCLADGRTNEKPERALPMTPRAGGWFES
TVAEAGAGIRYGFDVNGARVPDPASRFNPDDVHGLSEVIDPSAFAWQDAKWRGRPWEEAV
IYELHVGTFSPEGTFKGVSQRLDYLVELGVTAIELMPVADFPGSRNWGYDGVLLYAPDSR
YGRPEDLKELVQAAHERGLMILLDVVYNHFGPEGNYLHLYAKEFFTGRHHTPWGAAINFD
GPASGRVREFFIHNALYWLQEYHFDGLRLDAVHAIIDHSSPHILVELAERVRAEVGTERH
VHLILENDANNARYLTNSWYDAQWNDDIHHALHVLSTQEGDGYYVDYADNPVRHLGRCLA
EGFAYQGEISVYRDDMARGEASIHLPPQAFISFLQSHDQAGNRAFGERISHIGEEALTRM
AAAIYLLAPGIPMLFMGEEFAAKSPFLFFCDFGPELREAVTQGRRREFARFAHFTQDMDE
TAIPDPNAVQTFLISKIDWDLLRNEAHFAWLEYYRNLMKLRSEIIVPRLRGMKGNSAHFE
VFAPKCLWVCWQLGDDSTLRLLANFSDESVAAPRFGGQIVFASPGAIPPSSRTTKSIPVK
SMLAPRSVVWMLEPAADKSKGSFTG
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
gtgctgacacgacttcacgacatgccttatggcactcaaatcacggaccacggagtgcgc
ttccgtctttgggcgcctggttgcaaacaggtgggattgtgccttgcagacggacggacg
aatgagaagcccgaacgggcactccccatgactccccgcgcaggaggatggttcgagtcg
actgtagcggaagcgggagcgggaatacgctatgggttcgatgtgaacggtgcccgcgtg
cccgatcccgcttcgcgcttcaatccggatgatgtgcatggtttaagtgaggtgatcgat
ccttcggccttcgcctggcaggatgcgaaatggcgtggacggccatgggaagaagccgtc
atctatgagctgcatgtaggcacgttctcgcccgaaggaaccttcaagggcgtctcccag
agactggactatctggtcgaactcggtgtgaccgccattgagctcatgccggttgccgat
tttccgggctcacgaaactggggctatgacggcgttctgctttacgcgccggatagccgt
tacggacgtccggaggatctcaaggaactggttcaggccgcgcatgaacggggactgatg
attctgctcgatgtcgtctacaatcacttcgggccggaaggaaactatcttcacctttat
gcaaaggaattctttactgggcgccatcacactccgtggggtgcggcaataaatttcgat
ggccccgcaagtggacgggtacgcgagtttttcatccacaacgcgttgtattggctgcaa
gagtatcatttcgacggcctgcggctcgatgcagtccacgcgatcatcgaccattccagt
ccgcacatccttgtcgaactggcggagcgtgttcgtgccgaggtcggtacagagcgccac
gtgcatctgatcctggaaaacgatgccaacaatgcccgctatctgacaaatagttggtac
gacgcgcagtggaacgacgatattcaccacgctctgcatgtgctttctacacaggagggc
gatggatactatgtggattatgccgacaatccggtacgccatctcgggcgctgcctggcg
gaagggtttgcctatcagggagagatatccgtttatcgcgacgatatggcgcgtggagag
gcgagcattcatctgccgccccaggctttcatttcctttctgcaatcccacgaccaggcg
ggcaaccgtgcatttggcgagcgtattagtcatattggcgaggaagcgttgacacgtatg
gcggcagccatctatttgctggctcccggcattcccatgctgttcatgggcgaggagttt
gccgcaaaatcgcctttcctgtttttctgcgacttcggaccggagctgcgcgaagctgtg
acacaggggcgacgcagggaatttgcccgctttgcgcattttacgcaagacatggacgag
acagcgataccggacccgaatgctgttcagacttttcttatctcgaaaatcgattgggat
ttactcaggaatgaagctcactttgcctggctggagtattaccgcaaccttatgaaactt
cgcagcgaaattatcgtaccgcgccttcgcggaatgaagggtaattcggcacattttgag
gtattcgcgcctaaatgcctgtgggtctgctggcagttgggcgacgattccaccttgcgg
ctattggcgaatttttccgacgagagcgtggcggctccccggttcggcgggcagatcgtg
tttgcctcacccggtgcaatacccccatcttcccgaacaaccaaaagtatcccggtgaaa
agtatgctggcgcctcgttcggtagtctggatgcttgaaccggctgccgataaaagtaaa
ggcagttttaccggataa

DBGET integrated database retrieval system