KEGG   Nitrosospira multiformis: Nmul_A1761Help
Entry
Nmul_A1761        CDS       T00302                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmu  Nitrosospira multiformis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nmul_A1761
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Nmul_A1761
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nmul_A1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2011558..2012607
Genome map
AA seq 349 aa AA seqDB search
MSLGPVILDIEGTQLTANDKKKLRHPLVGGVILFTRNYSSLAQLMHLTAEIHALRTPPLL
VAVDHEGGRVQRFREDFTRLPPMRELGRIWDEHPAQARHLAHEAGYVLAAELRAAGVDFS
FTPVLDMDYGQSSVIRDRAFHRDPQAIAELAHSLMSGLKSAGMAAVGKHFPGHGYIEADS
HFEMPVDERTYAQIEMDDLIPFRKMIGFGLTGMMPAHVIYPKVDALPAGFSEVWLKKVLR
GELGFEGCIFSDDLNMAGAAFAGNPVERAQKALHAGCDMVLLCNNPEAAEMLLAELHWDL
PALGVIRLARMRGRPNPDSLVKLHENPNFVSAVEKIAGIGVRSGELPLV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctcggtcccgtcatactcgatatcgaaggcacgcaactcaccgccaacgataag
aaaaaactccggcacccgctggttggaggggtgatcctgttcacgcgcaactattcctcg
cttgcgcaactcatgcatctgactgctgaaatccatgcgctgcgaacgccgccactcctg
gtcgccgtcgatcacgaaggaggcagagttcaacgtttccgggaagatttcacgcgcctg
ccccccatgcgagaactgggcaggatctgggatgagcatcctgcccaggcgcggcatctg
gcgcatgaggcgggatatgtcctggcggcggaactacgggctgcgggcgtggacttcagt
tttacaccggtcctggatatggattatggccaaagcagcgtcatccgcgaccgtgctttt
caccgtgacccgcaagccattgccgagctggcccatagcctgatgagcgggttgaaatca
gccggaatggcagcggtgggcaaacatttccctggtcatggttatatcgaggccgattcc
catttcgaaatgccggtggacgaacgaacttacgcgcagatcgaaatggacgatcttatt
ccattccgtaaaatgatcggtttcggccttaccggcatgatgcctgcccacgtcatttat
ccaaaggtggatgcattaccggccggtttttccgaagtatggctcaaaaaggttttgcgg
ggtgagctgggtttcgaagggtgtatcttcagcgacgatctgaatatggcgggagcagct
tttgcaggcaatccggtggagcgggcccagaaagcattgcatgcgggatgcgacatggtg
cttctgtgtaataacccggaagcggccgaaatgctgctcgcggagctacattgggacctg
cccgcccttggggtgattcgtctcgcccgcatgcgcgggcgcccaaacccggattcgctg
gtgaaactgcacgaaaacccgaacttcgtcagtgccgtggaaaaaattgcgggtatcggc
gttcgcagcggcgagttgccgctggtgtag

DBGET integrated database retrieval system