KEGG   Nitrosospira multiformis: Nmul_A1868Help
Entry
Nmul_A1868        CDS       T00302                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:nmu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:nmu00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nmu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nmu00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:nmu00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2154508..2155428
Genome map
AA seq 306 aa AA seqDB search
MIQDHKVTTFYTAPTAIRSLIKLGPDLPKQYDLSSLRLLGSVGEPINPEAWMWYYTTVGQ
SRCPLVDTWWQTETGAHMIAPTPGAVMLKPGSCTLPLPGIKAGIVDEAGHDVPVGKGGFL
VIKRPFPSLARTLWGDPERFRNTYFPEELGGKYYLAGDSAHRDADGYFWIMGRIDDVLTV
SGHRLGTMEIESALVASPLVAEAAVVGKPDEIKTEAIVAFVVLKGARPKAEDAHRIVQEL
RNWVSQEIGPIARPDEIRFGDNLPKTRSGKIMRRLLRTLARDEEITQDVSTLENPAILEQ
LKQAVA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggatcataaggtgaccacgttttataccgcccccactgccatccgctcgctt
ataaaactcggacccgacctgccgaaacaatatgacctttcctcattgcgcctgctcggt
tcagtgggcgaaccgatcaacccggaagcgtggatgtggtattacacgaccgttggccaa
tcccgctgtccgttggtggacacctggtggcaaaccgaaacaggcgctcacatgatcgcc
cccacgcctggagcagtaatgctcaagcccggttcctgcactttgccgctccccggtatc
aaagccggtatcgtggatgaagccgggcatgatgtgccggtaggcaaaggggggtttctc
gtgatcaagcgtccgtttccttccctggcccgcaccttgtggggagatccggaacgcttc
agaaatacctattttcccgaagagcttggcggtaaatactatctcgcgggagattcggct
catcgcgatgcggacggctatttctggatcatggggcgcatcgacgatgtactgactgtt
tccggccaccgtttagggacaatggaaatcgaatcggcgctggtagcgagccccttggtt
gctgaagccgcggtggtaggcaagccggatgaaatcaaaaccgaggccatcgtggctttc
gtggtattgaaaggggctcgcccgaaagcagaggacgctcatcgcattgtgcaggaattg
cgcaattgggtatcgcaggagatcggccccatcgcccggcctgatgaaatccgttttggg
gataacctgccgaaaaccaggtccggcaaaatcatgcgccggttgttgcgcacgctggca
agggatgaagaaataactcaggatgtatccaccctggaaaacccggcgatacttgaacaa
ttgaaacaggcggtagcgtag

DBGET integrated database retrieval system