KEGG   Nitrosospira multiformis: Nmul_A1872Help
Entry
Nmul_A1872        CDS       T00302                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00010  Glycolysis / Gluconeogenesis
nmu00052  Galactose metabolism
nmu00500  Starch and sucrose metabolism
nmu00520  Amino sugar and nucleotide sugar metabolism
nmu00521  Streptomycin biosynthesis
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1872
   00052 Galactose metabolism
    Nmul_A1872
   00500 Starch and sucrose metabolism
    Nmul_A1872
   00520 Amino sugar and nucleotide sugar metabolism
    Nmul_A1872
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nmul_A1872
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Nmul_A1872
Enzymes [BR:nmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nmul_A1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABB75167
JGI: NmulA1872
UniProt: Q2Y7V4
Position
complement(2158172..2159176)
Genome map
AA seq 334 aa AA seqDB search
MNEYFISGDIGGTKTLLQAAELKEGNVRVWGERRYESPAYSSFSDMLRDFINEVSALDSD
GNPMSACFAVAGPIARQEAALTNLPWVMNSAVLSSEFSIPKVKLINDFAAVASGVGILPE
HDLMTLQAGQPHVGKMRVVLGAGTGMGVAWLVWQNGDYSSLPSEAGHIDFAPANELQDRL
LHHLRKRLGHVSVERVLSGPGLTNIFRFLQDESGDKREWTSTQSKEDDAARISDLAFNQK
HPLAAKAMDLFVEIYGAYAGNLALAGLCRGGVYVAGGIAPKIIDKLREGGFMKAFRDKGR
FSGLMEEIPVHVVMNPKVGLLGAAEEARRMLDEV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaatatttcattagtggcgacatcggcggaaccaagacattgctgcaagcagcg
gaactgaaagaaggcaatgtccgggtatggggcgaacggcgctacgagagtccggcctat
tcgagtttttcggacatgctccgagactttattaatgaagtctccgcgctcgatagcgat
ggcaatcccatgagcgcctgtttcgcggtagcggggccaattgccaggcaggaagcggca
ctcacaaatttgccgtgggtgatgaactctgcagtgctttcctcggaattttccattcca
aaggtcaagctcatcaacgacttcgcggccgtggcatcgggtgtgggcatcctgccggaa
cacgacctgatgacattgcaggccggccagcctcatgtcggcaagatgcgagtcgtgttg
ggggcgggtaccggcatgggagtggcatggctcgtctggcaaaatggagactactcatcg
ctgccgagcgaagccgggcatattgattttgcgccagcgaatgaattgcaggaccgattg
ttgcatcatctgcgaaaacgcttgggccatgtatcggtcgagcgggtgctctccggtccg
ggactgacaaatatttttcgttttcttcaggatgagtcaggcgataaacgcgaatggaca
tcgacgcagtcgaaagaagatgatgccgctcgtatatccgatctcgccttcaaccagaag
catccgttagcagcgaaagcaatggatttatttgtggagatttacggagcctacgccggc
aacctggctttggccggtctgtgccgcggtggggtatatgtggcgggagggattgcacca
aaaattatcgataaattgagagaaggcggtttcatgaaagcatttcgcgacaagggacgc
ttttccgggctaatggaggaaattccggtacatgtagtgatgaatccaaaagtcggacta
cttggggctgcggaagaagccaggagaatgctggatgaggtgtaa

DBGET integrated database retrieval system