KEGG   Nitrosospira multiformis: Nmul_A1911Help
Entry
Nmul_A1911        CDS       T00302                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmul_A1911
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmul_A1911
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmul_A1911
Enzymes [BR:nmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nmul_A1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2201415..2202254)
Genome map
AA seq 279 aa AA seqDB search
MSRISTLFGKLLQNRRKALIPFITAGDPEPGMMVPLMHELVQAGADVIELGVPFSDPMAD
GPTIQRSSERALKHRVSLQDVLAMVGEFRESDSSTPVVLMGYANPVEAMGYDAFTARSKA
CGVDGVLIVDYPPEESVKWVEYLKRQNIAPIFLLSPTTPQQRVERVASLAEGYVYYVSLK
GVTGSLHLDLHDVAEKLDGLRSRISIPIGVGFGIRDGATARAVAELADAVVVGSRIIEEI
ERSPKAEVLTNVHRLVKSLRIAIDAASPAPSAAVKLTHL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatttccaccctgtttggcaaactgctccagaatcggagaaaggcgctcatt
ccttttattactgctggcgatcccgaacccggaatgatggttccactgatgcatgaactg
gtgcaggctggcgccgatgtcatcgaactgggtgttccattttctgatccgatggcggat
ggaccaacgattcagcgctcttccgagcgtgcgctgaaacatcgcgtttcgttgcaggac
gtattggcaatggtgggagaattcagggaaagtgattccagcacgccggttgtgctgatg
ggctacgccaatccggtcgaagcgatgggctacgatgctttcacggcaagatcaaaggcg
tgcggagtggatggcgtgctgattgtggattatcctccggaagaatcggtgaaatgggtg
gaatacctgaaacgtcagaatatcgctcccattttcctgctttctcccactacgccgcag
cagcgcgtcgagcgggtggcctccctggcggaaggatacgtgtactacgtttcgctgaaa
ggcgttaccggttcgcttcacctcgatttgcatgacgtggccgagaaactcgacggactg
cgttcccgcatttccattcctatcggagtgggctttggcatacgtgacggcgcaaccgcc
cgggcagtggcggagcttgccgatgcagtggtggtgggaagccgcatcatcgaagaaatt
gaaaggtcgcccaaggcggaggtgttaacaaatgtccatcgtctggtaaaaagtctgcga
attgcaatagacgcagcaagtcctgcaccatcagccgccgttaaacttacacacttatga

DBGET integrated database retrieval system