KEGG   Nitrosospira multiformis: Nmul_A1912Help
Entry
Nmul_A1912        CDS       T00302                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nmul_A1912
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nmul_A1912
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nmul_A1912
Enzymes [BR:nmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nmul_A1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2202271..2203467)
Genome map
AA seq 398 aa AA seqDB search
MKVYDLPDSHGHFGPYGGIFVAETLISALEDLRIQYERYRSDADFQAEFAHELKHYVGRP
TPIYHAKRWSAQLGGAQILLKREDLNHTGAHKINNAMGQALLARRMGKSRVIAETGAGQH
GVATATVAARYGMECVIYMGSVDVERQAANVYRMKLLGAEVIPVESGSRTLKDALNEAMR
DWVTNVADTFYIIGTVAGPHPYPMMVRDFQAIIGREAITQMQEDYGRQPDALIACVGGGS
NAIGLFYPYLDSSIRMIGVEAAGHGVETDQHAATLTKGRPGVLHGNRTYLIQDENGQIVE
THSISAGLDYPGVGPEHAWLKDSGRAEYFGITDEQALEAFHALCHYEGIIPALESSHALA
YAARLAPALTSDKLLLVNLSGRGDKDMPTVARASHITF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtctatgatcttccggacagtcatgggcactttggtccgtatggcggcatcttt
gtcgctgaaacgctgatctcggcactggaggatttacgcatacagtacgagcgctatcgc
agcgacgccgactttcaggcagaattcgcccatgaactcaagcattatgtgggacgcccg
actcccatctatcatgcaaaacgatggtctgcgcagctggggggcgcccagatcctgctc
aagcgcgaggacctgaaccatacgggcgcccacaaaatcaataatgcgatgggacaggcg
ctgctggcaaggcgcatgggcaaatcgcgggtaatagccgagaccggcgcaggccagcat
ggtgttgccacggccacggtcgcagcgcggtatgggatggagtgtgtcatctacatggga
tcggtcgatgtggagcgccaggctgccaatgtttaccggatgaagcttctgggtgcggag
gtcataccggtcgaatccggctcacgcacgctgaaggatgctttgaacgaggccatgcgc
gactgggtgaccaatgttgcggataccttttacatcatcggtactgtggccggacctcat
ccctatcccatgatggtacgggatttccaggcgatcatcgggcgcgaggccataacccag
atgcaggaggattacggacggcagcccgatgccctgatcgcctgcgtggggggggggtca
aatgccatcgggcttttttatccctacctcgacagcagcatccggatgatcggagtggaa
gcggccggacacggcgtggagacggatcagcatgccgctaccctgacgaagggacgccct
ggcgtgttgcacggcaatcgcacttacctcatccaggatgagaatgggcagatcgtcgaa
acacattccatttcggcaggcctggattatcccggcgtagggccggagcatgcctggctc
aaggacagcggacgggccgaatatttcggaataaccgacgagcaggctctggaagccttc
cacgcactgtgccattacgaagggatcattcccgcgctcgaatccagtcatgcgctggct
tatgcagcccggctcgcgcctgccctcacttccgacaagttgctgctggtgaacctctcg
gggcgtggggacaaggatatgcccaccgtggcgcgcgcttcgcatatcaccttctaa

DBGET integrated database retrieval system