KEGG   Nitrosospira multiformis: Nmul_A1937Help
Entry
Nmul_A1937        CDS       T00302                                 

Definition
zinc-containing alcohol dehydrogenase superfamily protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmu  Nitrosospira multiformis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Nmul_A1937
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nmul_A1937
  Lipid metabolism
   00071 Fatty acid degradation
    Nmul_A1937
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmul_A1937
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Nmul_A1937
   00626 Naphthalene degradation
    Nmul_A1937
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Nmul_A1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2227666..2228700)
Genome map
AA seq 344 aa AA seqDB search
MAMQNQDGLMQAMVLDAPREKVQVRRIPRPRPGPDQLLIEIAACAVCRTDLHVVDGELPH
PKLPIIPGHEIVGRVIARGADVRDFAVGDRIGIPWLGWTCGHCRYCLEGRENLCPNARFT
GYQIDGGYAEYTVADARYCFRIPDRYSDLEAAPLLCAGLIGYRALKMTGNAERVGIYGFG
AAAHIVAQILHYQGCRLFAFTRPGDAAAQEFAHKMGADWVGSSDTMPPEELDAAIIFAPA
GALVPIALRAVCPGGIVVCGGIHMSDIPAFPYDILWREKRLVSVANLTRQDGEEFLKLAA
QVPIHVTTESFPLGEANTALTRLREGKLTGAAVLIPKKGNVSLP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcaaaaccaagatggcttgatgcaggcaatggtgctggatgcgccccgagaa
aaggttcaagtgcgccgtatcccgcgcccccggccgggtcctgatcagttattgatcgag
attgcagcgtgtgcagtctgccgcaccgacctgcacgtagtggacggtgaactgcctcat
ccgaaactgcctattatcccggggcatgaaatcgttggacgcgtaattgcacgcggagcg
gatgttcgggatttcgcagtgggagacaggatcggtattccctggctgggctggacatgc
ggtcattgccgctattgtctcgagggacgggaaaacctgtgcccgaatgccagattcacc
ggttatcagatcgacggcggttacgcggaatatacggtcgcagacgcccgctattgtttt
cgcattccggaccgttatagcgacctggaagctgccccgctgctgtgcgccggattgatc
ggctaccgcgcgctcaagatgaccggcaatgccgaacgggtaggtatctacggctttggc
gccgccgcccacattgtcgctcaaattctgcattatcaagggtgcagactttttgcattt
acacgccccggtgatgcggccgcccaggaattcgcccacaagatgggcgcagactgggtg
ggcagttcggatacgatgcccccggaagaactcgatgcggcgatcatcttcgctccggca
ggagctcttgtgcctatcgctctgcgcgctgtttgtcccggtggaatcgtcgtctgcgga
ggaattcacatgagtgacattcccgcttttccttatgacatcctgtggcgggaaaaacgt
ctggtttccgttgccaatcttacccgtcaggatggtgaggaatttttaaagctggcagcg
caagtgccaatccacgtgactacggaatcctttccgctcggcgaagcgaatacggctttg
acaagattgcgggaaggaaagctgacaggcgcggcagtgctcattccgaaaaaagggaac
gtttccctcccctga

DBGET integrated database retrieval system