KEGG   Nitrosospira multiformis: Nmul_A1963Help
Entry
Nmul_A1963        CDS       T00302                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nmu  Nitrosospira multiformis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmul_A1963
   00670 One carbon pool by folate
    Nmul_A1963
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Nmul_A1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2257389..2257940
Genome map
AA seq 183 aa AA seqDB search
MTPRLSVLVAMARNRAIGHKNAIPWHLPHDLKHFKELTMGHPMIMGRKTYESIGRLLPGR
TSIIITRQPDYEVPGALVVSSIGEALSACKQIRSGEEGHPDQGNECFVIGGADIFQQMLP
LCDRLYMTEIHRDFEGDTYFPEFDRNDWWEVSREEHVDDSGLEYHFVTLDRMASQQEQGA
QRL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgacacctcgactctccgttttggtggcgatggcgcgaaatcgcgccatcggtcataag
aacgcgatcccctggcacttgccgcacgacctcaagcatttcaaggagcttacgatgggg
catcccatgatcatgggacgcaagacgtatgaatccatcggccggcttcttcccggccgc
accagcatcattatcacaagacaacctgattatgaagttccgggcgcactggtggtcagc
tccataggagaagcgctcagcgcctgcaagcagataagaagcggagaagaggggcatccc
gatcaagggaacgaatgtttcgtcattgggggtgcagatatattccagcaaatgctgccg
ctatgtgatcgcctgtatatgaccgagatccacagggatttcgagggtgatacgtatttt
ccggaatttgacaggaatgattggtgggaggtctcgcgcgaagagcatgtggatgacagt
gggctggagtaccattttgtcacactcgatcgcatggcgagtcagcaggaacaaggcgct
cagcgactctga

DBGET integrated database retrieval system