KEGG   Nitrosospira multiformis: Nmul_A1973Help
Entry
Nmul_A1973        CDS       T00302                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nmu  Nitrosospira multiformis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nmul_A1973
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nmul_A1973
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Nmul_A1973
Lipid biosynthesis proteins [BR:nmu01004]
 Fatty acid synthase
  Component type
   Nmul_A1973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2270834..2271460
Genome map
AA seq 208 aa AA seqDB search
MGPAPAPASGATTVMVFGDSLSAGYGLPPDAGWVNLLKNRLQAQSQTYLINNSISGETAW
GGRNRIEKALKTHRPDIVIVELGGNDGLRGASIGSIRDNLEAIIEACKRNNATVLLAGMQ
LPPNYGITYTQKFQDIYPQLAKRHDIKLVPFLLDGFGNKREFFQADGIHPTARAQEKIVE
NVWKVLRTMLEAPQKSSPPLAYDSPETR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtggggccggcgcccgcgcccgcctccggagccacgaccgttatggtattcggcgacagt
ttatctgccggttatggcttgcctccggatgcaggctgggtcaacctgctcaagaaccgg
ctgcaagcacaatcacagacatatctgatcaataacagcatcagtggcgagaccgcatgg
ggaggacgcaaccggatcgagaaagcgctcaagacccatcgtcctgacatcgtcattgtc
gagttgggaggtaatgacggactgagaggagcgtccatcggatccatccgggacaatctc
gaagccatcattgaagcctgcaagcggaacaatgccactgtactgttggccggaatgcaa
ttgccgccaaattatggcataacatatactcaaaagtttcaggatatttaccctcaactc
gccaaacgccacgacatcaaactcgtgccgtttctcctggatggcttcggtaacaaacgc
gaattttttcaggcagatggaatacatcccaccgctcgggcccaggaaaaaatcgtggaa
aacgtctggaaagtgttgagaacgatgctcgaggctccccagaaatcttcaccaccgctt
gcttacgactctccggagacgcggtga

DBGET integrated database retrieval system