KEGG   Nitrosospira multiformis: Nmul_A1996Help
Entry
Nmul_A1996        CDS       T00302                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00020  Citrate cycle (TCA cycle)
nmu00640  Propanoate metabolism
nmu00660  C5-Branched dibasic acid metabolism
nmu01100  Metabolic pathways
nmu01110  Biosynthesis of secondary metabolites
nmu01120  Microbial metabolism in diverse environments
nmu01130  Biosynthesis of antibiotics
nmu01200  Carbon metabolism
Module
nmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nmul_A1996
   00640 Propanoate metabolism
    Nmul_A1996
   00660 C5-Branched dibasic acid metabolism
    Nmul_A1996
Enzymes [BR:nmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nmul_A1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABB75291
JGI: NmulA1996
UniProt: Q2Y7I0
Position
complement(2292754..2293950)
Genome map
AA seq 398 aa AA seqDB search
MKIHEYQAKHILHQFGIPIPRGHSCFNVDEAVATAKKLGGSTWVVKAQIHAGGRGKGGGV
KIARSLDEVKQFAEKILGMTLVTPQTGSQGQIVRRLLVEQGLDIRKEFYIGLVVDRGRRR
VCLMASAEGGMDIERVAADYPEKIHKVYIDPGAGLTATEAEDITSRIGFSGAAVAETAAL
LQNLYRAYDSTDASLVEINPLILTGENRIVALDAKMNFDDNALFRHPDIADLRDLDEEDA
AEIEASRYGLSYISLDGNIGCLVNGAGLAMATMDIIKFYGGNPANFLDVGGGATTEKVME
AFKLMLRNPRLQAILINIFGGIMKCDVIAEGVVAAAREVRLNVPLVVRLEGTNAEIGKKI
LTESGLAIISAANMADAAEKAVTAAASATSAAMPATGS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgaataccaggccaaacatatcctgcatcagtttggtatacccatacct
cgagggcattcctgcttcaacgtggatgaagcggtggcaaccgctaaaaaactgggtgga
agcacatgggtggtcaaggcccaaatccatgcagggggacgcgggaagggtggcggggtg
aagatcgccagatcgcttgacgaggtgaaacaatttgccgaaaaaatactcggcatgacg
ctcgtcacgccacagacgggttcgcagggtcagatcgtacgacggctgctggtcgaacag
ggtctcgatatcaggaaggagttctacattggactggtggtggatcggggccgccgccgt
gtctgcctgatggcgagtgccgaaggggggatggatatcgagcgggtcgctgccgattat
ccggaaaagatccacaaagtgtatatcgatccgggggcgggactgaccgctacggaagcg
gaagatatcacgagcaggatcggcttttccggtgcggcagtggcggaaacggctgcactg
ttgcagaatctataccgcgcttacgacagcacggacgcatcgctcgtcgaaatcaatccg
ctgatactcaccggcgaaaatcgcattgtcgcgctcgatgcgaagatgaattttgacgat
aacgcgcttttccggcaccccgatatcgccgacttgcgtgatcttgacgaagaagatgcg
gcagagatcgaggcgtccagatacggtctttcctacatctcgctcgatggcaacataggt
tgcctggtaaatggagccggtcttgcaatggctaccatggatatcatcaagttctacgga
ggaaatccggccaattttctcgacgtgggaggaggcgcaaccactgaaaaagtcatggaa
gccttcaaactgatgctgcgcaatccaagactgcaagccatactgatcaatatattcggg
ggcatcatgaaatgtgatgtcattgcagagggagtagtggcagcagcgcgtgaagtaagg
ttgaatgttcccctggtggttcgtctcgaaggcacgaatgcggagatcgggaaaaagatc
ctgaccgaatcaggtcttgccatcatttcagccgcgaatatggcggatgccgcggaaaag
gccgttaccgcagccgcatcagccacctcggccgccatgccggccacagggtcgtga

DBGET integrated database retrieval system