KEGG   Nitrosospira multiformis: Nmul_A2141Help
Entry
Nmul_A2141        CDS       T00302                                 

Definition
(GenBank) Fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu01040  Biosynthesis of unsaturated fatty acids
nmu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nmul_A2141
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Nmul_A2141
Lipid biosynthesis proteins [BR:nmu01004]
 Desaturase
  First
   Nmul_A2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 HTH_28 HTH_23 ABC1 HTH_Tnp_1 HTH_8 RWP-RK RNase_HII
Motif
Other DBs
NCBI-ProteinID: ABB75434
JGI: NmulA2141
UniProt: Q2Y737
Position
complement(2433113..2434282)
Genome map
AA seq 389 aa AA seqDB search
MTLGLIDLPWWGYIAVTLGLTHITIASITIFLHRHQAHRSLDLHPLPSHFFRFWLWLTTG
MVTKEWTAIHRKHHAKCETVDDPHSPQIVGIAKVLREGSELYRAEAKNMETMERYGHGTP
DDWLERNVYDKHSRKGVALMLIIDVILFGPIGLTIWAIQMAWAPIMAAGVINGIGHYWGY
RNFQAEDASTNIVPWGILIGGEELHNNHHAYATSARLSNKWYEFDIGWMYICILQWMGLA
QVKKVAPKLRLDAAKTECDADTLQAVISHRYEVLAKYAQSLKQTLAKEVDHLKEAATNLG
VDRSTLKRWVLADSKTLQEDERAKLNLVLSKTSTLDKVYKMREELITVWQRSTSSKDELV
KQLEDWCHRAEESGIEVLQNFSRRLRCYA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactctcggtcttatcgacttgccatggtggggttatatcgccgttaccctcggcctt
acccacataaccatagccagtatcacaatctttctgcatcgtcatcaagctcatcgctcg
ctggatcttcatcccttgccgagtcattttttccgcttctggctgtggctcacgaccggg
atggtcaccaaggagtggaccgccatacaccggaagcatcatgccaagtgtgaaacggtc
gatgatccccatagtccgcaaatagtggggatcgccaaagtgctgcgggagggatcggag
ctctaccgcgcagaagccaaaaacatggaaaccatggaaagatacggccatggtacgccg
gatgactggctggagcggaatgtctatgacaagcacagccgcaagggggtggccctcatg
ctgatcatcgacgtcattctgttcggacccatcggcctgaccatctgggccatccagatg
gcatgggcgcccatcatggctgcgggcgtgatcaatgggataggacattactggggctac
cgtaatttccaggccgaagacgccagcaccaatatcgttccctggggaattctcattggc
ggagaggagttgcacaacaaccaccacgcttatgccacttccgcgcgcttatccaacaag
tggtatgaattcgacatcggctggatgtatatttgcattctccagtggatggggttggcg
caagtgaagaaggtggcgccgaaactgcgcctcgatgccgcaaagacagaatgcgacgca
gatacgctgcaagctgtcatttcccatcgctacgaagtactggcaaagtatgcccagtct
ctcaagcagacgctggcaaaggaagttgatcatctgaaagaagcggcgacaaatcttggc
gtcgatcgttccacactcaagcgttgggtacttgcggactccaagaccctgcaggaagac
gagcgggcaaagctcaatctagtgctgagcaagacgagtacgctggataaagtttacaaa
atgcgcgaggaattgataacggtatggcaacgctccacttcatccaaggatgagctggtc
aagcagctggaagactggtgtcaccgcgccgaggaaagcggcatcgaggtattgcagaat
ttctcccgcaggctgcgctgctacgcttag

DBGET integrated database retrieval system