KEGG   Nitrosospira multiformis: Nmul_A2156Help
Entry
Nmul_A2156        CDS       T00302                                 

Definition
(RefSeq) tyrosinase/peptidase
  KO
K00505  
tyrosinase [EC:1.14.18.1]
Organism
nmu  Nitrosospira multiformis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nmul_A2156
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Nmul_A2156
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Nmul_A2156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2450361..2451848)
Genome map
AA seq 495 aa AA seqDB search
MGTRKNQSTLTAAEKAAFVGAVKALKANGSYDVFVAQHRTAFLAGVNDPAHGGPAFLPWH
REYLRRFERALQQIDPSVSIPYWDWTVDRTTNASIWNANFMGGNGTGPGGRVMTGPFAFS
TGEWTLTVLDPGDTDNFLTRAFGAMGALPTQQGVNAAINIVPYDSAPWNRNSSMNTSFRN
HLEGIIHNPGHMWVGGSMMAMSSPNDPVFWLHHCNIDRLWAVWQRENPGQNYRPPSGTAG
VVNGHGLDDPMPPWNNEASPPTPRDVLDHHALGYTYDDEEEEPPQIVPLTLDAAPFAASI
GQAGEVDTYSFVASSQGNYIIETEGSTDVVAALYGPDDANALVAEDDDSGVGRNPRIARD
LAPGTYYVRIRHYSGSSTGSYRISVRGSGGPQPGIQTIQINGPAVQGTLSANERDLYTFT
VSTSGSHTIETAGSTDCFLTLFGPDSQTAVIAQDDDSGPGTNSRIVQNLGAGVYYVQVRH
YSPTGTGAYSVSVRT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggaacccgaaagaatcaatccacgttgacagccgcggagaaggcggcctttgttggg
gcggtaaaagcactcaaggcaaatggctcctatgatgtattcgtggcccagcaccgtacc
gcctttcttgccggcgtgaacgatccggcacatggcggtcctgcctttctgccttggcac
agggagtatctccgccggttcgagcgtgcccttcagcagatcgatcccagtgtttccatc
ccctattgggactggacagttgatcgcacgacgaatgcttccatctggaatgcgaatttc
atgggtggaaatggaacgggccccggcggacgcgtgatgacggggccgttcgccttttcc
acgggagagtggacgcttactgttctggaccccggtgacacggataattttctcacccgt
gccttcggcgccatgggagcgttgcccacccaacagggagtgaatgccgccatcaatatc
gtgccctatgattcagcgccctggaatcgtaacagcagcatgaatacgagttttcgaaac
catctcgaggggattatccacaatcccggccacatgtgggtaggcggctcgatgatggct
atgtcctcccccaacgatccggtgttctggctgcatcattgcaatatcgatcggttatgg
gcagtatggcagcgggaaaatccggggcagaattatcgtccgccgagcggcacggcgggc
gtggtgaacggccatggactggatgacccgatgccgccctggaacaacgaagcttcgccg
cctacgccccgggatgttctcgatcaccatgcgcttggctacacgtacgatgacgaggaa
gaagaacctccgcagatcgtacccctgacccttgatgcggctccgtttgccgcttccata
ggccaggcgggagaagtggacacatatagcttcgttgcctcaagccaggggaattatatt
atcgaaaccgagggttccaccgatgtagtggccgccctgtatggtccggatgatgccaat
gcgctcgttgccgaggatgacgacagcggcgtcggccggaatccgcgcattgcacgagac
ctggcgccgggaacatactatgttcgcataaggcactatagcggctcatccactggaagc
taccgtatttcagtacgagggtcaggaggcccgcagccgggtatccagaccattcagata
aatggtccggcagtgcagggcacactctccgccaatgagagggatctgtacacctttact
gtcagcacgtccggctcccatacgatagaaaccgctggtagcactgattgcttcctcacg
ttattcggccccgacagccagactgccgtcattgcccaggatgacgacagtggcccggga
accaattcgcgcatcgtgcaaaacctcggggccggtgtctattatgttcaggtcaggcat
tacagcccgaccggtacaggggcgtatagtgtttccgtcagaacatga

DBGET integrated database retrieval system