KEGG   Nitrosospira multiformis: Nmul_A2156Help
Entry
Nmul_A2156        CDS       T00302                                 

Definition
tyrosinase/peptidase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
nmu  Nitrosospira multiformis
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:nmu00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:nmu00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2450361..2451848)
Genome map
AA seq 495 aa AA seqDB search
MGTRKNQSTLTAAEKAAFVGAVKALKANGSYDVFVAQHRTAFLAGVNDPAHGGPAFLPWH
REYLRRFERALQQIDPSVSIPYWDWTVDRTTNASIWNANFMGGNGTGPGGRVMTGPFAFS
TGEWTLTVLDPGDTDNFLTRAFGAMGALPTQQGVNAAINIVPYDSAPWNRNSSMNTSFRN
HLEGIIHNPGHMWVGGSMMAMSSPNDPVFWLHHCNIDRLWAVWQRENPGQNYRPPSGTAG
VVNGHGLDDPMPPWNNEASPPTPRDVLDHHALGYTYDDEEEEPPQIVPLTLDAAPFAASI
GQAGEVDTYSFVASSQGNYIIETEGSTDVVAALYGPDDANALVAEDDDSGVGRNPRIARD
LAPGTYYVRIRHYSGSSTGSYRISVRGSGGPQPGIQTIQINGPAVQGTLSANERDLYTFT
VSTSGSHTIETAGSTDCFLTLFGPDSQTAVIAQDDDSGPGTNSRIVQNLGAGVYYVQVRH
YSPTGTGAYSVSVRT
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggaacccgaaagaatcaatccacgttgacagccgcggagaaggcggcctttgttggg
gcggtaaaagcactcaaggcaaatggctcctatgatgtattcgtggcccagcaccgtacc
gcctttcttgccggcgtgaacgatccggcacatggcggtcctgcctttctgccttggcac
agggagtatctccgccggttcgagcgtgcccttcagcagatcgatcccagtgtttccatc
ccctattgggactggacagttgatcgcacgacgaatgcttccatctggaatgcgaatttc
atgggtggaaatggaacgggccccggcggacgcgtgatgacggggccgttcgccttttcc
acgggagagtggacgcttactgttctggaccccggtgacacggataattttctcacccgt
gccttcggcgccatgggagcgttgcccacccaacagggagtgaatgccgccatcaatatc
gtgccctatgattcagcgccctggaatcgtaacagcagcatgaatacgagttttcgaaac
catctcgaggggattatccacaatcccggccacatgtgggtaggcggctcgatgatggct
atgtcctcccccaacgatccggtgttctggctgcatcattgcaatatcgatcggttatgg
gcagtatggcagcgggaaaatccggggcagaattatcgtccgccgagcggcacggcgggc
gtggtgaacggccatggactggatgacccgatgccgccctggaacaacgaagcttcgccg
cctacgccccgggatgttctcgatcaccatgcgcttggctacacgtacgatgacgaggaa
gaagaacctccgcagatcgtacccctgacccttgatgcggctccgtttgccgcttccata
ggccaggcgggagaagtggacacatatagcttcgttgcctcaagccaggggaattatatt
atcgaaaccgagggttccaccgatgtagtggccgccctgtatggtccggatgatgccaat
gcgctcgttgccgaggatgacgacagcggcgtcggccggaatccgcgcattgcacgagac
ctggcgccgggaacatactatgttcgcataaggcactatagcggctcatccactggaagc
taccgtatttcagtacgagggtcaggaggcccgcagccgggtatccagaccattcagata
aatggtccggcagtgcagggcacactctccgccaatgagagggatctgtacacctttact
gtcagcacgtccggctcccatacgatagaaaccgctggtagcactgattgcttcctcacg
ttattcggccccgacagccagactgccgtcattgcccaggatgacgacagtggcccggga
accaattcgcgcatcgtgcaaaacctcggggccggtgtctattatgttcaggtcaggcat
tacagcccgaccggtacaggggcgtatagtgtttccgtcagaacatga

DBGET integrated database retrieval system