KEGG   Nitrosospira multiformis: Nmul_A2281Help
Entry
Nmul_A2281        CDS       T00302                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
nmu  Nitrosospira multiformis
Brite
Enzymes [BR:nmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Nmul_A2281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_4 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NmrA RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-ProteinID: ABB75573
JGI: NmulA2281
UniProt: Q2Y6P8
Position
complement(2594014..2595006)
Genome map
AA seq 330 aa AA seqDB search
MTKSLITGANGFVGSAVTRCLLEAGHEVRCLVRPGSDRRNLDKLPVEISEGDLRSASSLK
RAVAGCDNLFHVAADYRLWVPNPDTMYEINVKGTRALVLAAAEAGMKRMVYTSSVATLGT
AENGVPADEDTPSSLGSMCGHYKRSKFMAEEIVQQMTREHDLPMVIVNPSTPIGPRDIKP
TPTGRLVVDTLRNRMPAYVNTGLNIVHADDIAEGHLLAYKHGKPGERYILGGENMTLLQI
LQKIDEIRGRRIRRLGLPVKLMVPAAWLMEKMSTVTKVEPRATVDSVSMAKKKMFYSSDK
AVRELGYRYRPAAAALEDAMNWFQANGYCG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtctttaataaccggagccaatggatttgtcggctccgcagtaacgcgctgt
ttactggaagcgggccatgaggtgcgctgtcttgtccgcccgggaagcgaccggcgaaat
cttgataagttgcccgttgaaatttcggagggtgatttgcgttccgcttcctcgctgaaa
cgggcggtcgccgggtgcgataacttgtttcatgtggcggcagactaccgcctgtgggta
cccaatccggataccatgtacgaaatcaatgtaaagggaacccgggcactggttcttgca
gccgccgaagctggaatgaaacgcatggtctataccagcagtgtggcgaccctggggacg
gctgaaaatggcgttcctgccgacgaagatacgccttccagcctgggatcgatgtgcgga
cactacaagcgatcgaaattcatggctgaagaaattgttcagcagatgacacgggaacat
gacctacccatggtcatagtcaatccttccacgccgataggaccgcgtgatatcaagcca
acccccaccggccgcctcgtggtggatacattgcgcaatcgaatgccggcatacgtgaat
accggcttgaatatcgtgcacgctgacgatatcgctgaaggccatctgctggcatacaag
catggaaaacccggcgaacgttacatcctcgggggggaaaacatgaccttgctgcagatt
ctgcagaaaatcgatgagataagaggcaggcggatcaggcggcttggccttcccgtcaag
ctgatggtgcccgctgcctggttgatggaaaaaatgtccaccgttaccaaggttgaaccg
cgcgctaccgtggacagcgtctccatggcaaagaaaaagatgttctactccagcgacaag
gcggtaagagaactgggttatcgctatcgcccggctgcggctgcgctcgaggatgcaatg
aactggttccaggccaacggttactgtggctag

DBGET integrated database retrieval system