KEGG   Nitrosospira multiformis: Nmul_A2367Help
Entry
Nmul_A2367        CDS       T00302                                 

Definition
D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase (EC:3.4.16.4)
Orthology
K07259  
D-alanyl-D-alanine carboxypeptidase / D-alanyl-D-alanine-endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nmu  Nitrosospira multiformis
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nmul_A2367
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Nmul_A2367
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nmul_A2367
Peptidases [BR:nmu01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Nmul_A2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2692495..2694141
Genome map
AA seq 548 aa AA seqDB search
MSLFTRLQRSLENPLENPQKNLPGNPLRNSHLVPLLRAIKWALCSLLVFLPPPALALDLP
DSVKYALARAGIPRSAVGIYVHETGAGQPLLAVNAGVGMSPASVMKLLTTFAGLELLGPG
YAWKTELYADGIVRGDALHGNLVIKGYGDPRLNLENFWLLTRRLRQTGLREITGDLVLDS
SHFDLPGSDSAAFDGRPYRAYNVLPEALMVNYRTLALRLLPQPESRSVRIVVDPLLPSLD
LKNSLTLTNGACNDWKDDLGTDIQFATGLDSRVSVTFKGSYALACGEKTLFLSVHDTARY
TFDLFRQLWEQQGGVLRGSVRRSAAPEGIVPLETHQSPPLTDIVRDINKFSNNTAARQLY
LTLGLGSGPFREPQVMPASFNIGYGNDRTAKSGTILSLDGIGEDPDPSRATLAKSETAIR
QWLASRQLVFPELILENGSGLSRNERISAGHMGKLLLAAFQSHVMPEFVSSLPIVAVDGT
MKKRLNRSAIAGQAHIKTGLLEGVKTIAGYVRDKSGRRSVVVFFINHPRAENGQAAMDAL
LDWVYEGR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgttcacacgtttgcaacgttccctggaaaacccgctggaaaacccgcagaaa
aacctgcccggaaatccattgagaaactcgcatctcgtaccgctattacgcgcaataaag
tgggcattatgcagtctgcttgtcttcctgccgccgccggctttggcgctcgacctgcct
gactcggtaaaatacgcgctcgcacgggcgggtatcccccggtctgccgtcggcatttac
gtgcatgaaaccggtgcaggacagccgctgctggctgtcaatgctggcgtcggcatgagc
ccggcttcggtgatgaagcttctgaccacatttgccggactggaactactggggccggga
tatgcctggaagacggagctgtatgctgacgggattgtccggggggatgcccttcacggc
aatctggtcatcaagggctacggcgatccgaggctgaatctggagaacttctggttgctc
acccgacggctgcgccagaccggattgcgcgaaatcaccggcgacctggtgctcgacagc
agccatttcgatctccccggaagcgactccgccgcattcgacggcaggccctatcgcgca
tacaacgtcctccccgaggcgctgatggtgaattaccggacgctcgcgctgcggctgctg
ccgcagccggaaagcaggagcgtgcgcattgtggtggaccccctgttgccctctctcgac
ctcaaaaacagcctgacgctcaccaatggtgcatgcaatgactggaaggatgatcttggc
acggatattcagttcgccacgggcctcgacagccgcgtgtccgtgacattcaagggcagc
tatgccctggcgtgcggcgaaaaaaccctgttcctcagtgttcacgacactgcccgctat
accttcgatctgttcaggcagttgtgggaacagcaaggcggtgttcttcgcgggagcgtg
cgcaggagtgccgctccggaaggaattgtgccgctggaaacccaccagtctcctcccttg
acggatatcgtgcgcgatatcaacaagttcagcaacaataccgcggcgcggcagctctat
ctcaccctggggctgggcagtggaccattcagggaaccgcaagtaatgccggcttccttc
aacatcggctacggaaatgatcgaaccgccaaaagcggaacaatactttccctggatgga
atcggagaagatcctgacccgtcacgcgcaaccctcgccaaatcggaaaccgccatccgg
caatggctcgcttcccgccaactggtctttcccgagctgatcctggaaaacgggtctggc
ttgtcgcggaatgaacgcatcagtgccggccatatgggcaaactgctgctcgccgcattc
cagagtcatgtcatgcccgagtttgtctcctccctgcccatcgtcgcagtggacggcacc
atgaagaaaagactcaaccgcagtgcaatcgccggccaggcccatatcaagacagggctg
ctggagggggtaaaaaccatagcgggttatgtgcgcgacaagtccggcaggcgctcggtc
gtggttttcttcatcaaccacccgcgcgcggagaacggacaggctgcgatggatgcgctg
ctcgattgggtctacgaggggcgataa

DBGET integrated database retrieval system