KEGG   Nitrosospira multiformis: Nmul_A2419Help
Entry
Nmul_A2419        CDS       T00302                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nmu  Nitrosospira multiformis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2756252..2756827
Genome map
AA seq 191 aa AA seqDB search
MDSNDSEFGIGDWQRLLRSLGEDPSRQGLRETPERVTRAWAHWTRGYKQDPAAILKTFAD
GGESYDELIVVRQIPVYSHCEHHLAPFFGHATIGYLPTGHIVGLSKLTRLVNCFAARLQV
QERLTQQVAQSLLEHLQPKAVGVILRCRHMCMESRGIAVAGEETVTSAMLGDLKTNAAQR
AEFLALAESHE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaatgattcagaattcggaatcggcgattggcagcgactgttgcgctctctc
ggcgaagaccccagccgccagggcctgcgcgaaacgccggagcgcgtgacacgcgcgtgg
gctcactggacgcgcgggtacaagcaggatccggcagcgatcctcaagacgttcgcggac
ggcggcgaaagctacgacgaattgatcgtagtgagacagatacccgtttactcgcactgc
gaacaccacctggctcccttttttggccacgcaaccatcgggtatctccccacgggtcat
atcgtcgggttgtccaaactgacgcgactggttaactgttttgcagctcgcctgcaggta
caggaacgcctgactcagcaggtggcacaatccctgctggagcacctgcaaccgaaggcg
gtcggcgtcattctccgctgccgccacatgtgcatggaatcgaggggaattgccgttgcc
ggggaagaaacggtaacgtcggccatgctgggcgacctgaaaacgaatgcagcgcagcgt
gccgagttcctggcattggccgagtcgcacgagtaa

DBGET integrated database retrieval system