KEGG   Nitrosospira multiformis: Nmul_A2419Help
Entry
Nmul_A2419        CDS       T00302                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
nmu  Nitrosospira multiformis
Pathway
nmu00790  Folate biosynthesis
nmu01100  Metabolic pathways
Module
nmu_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nmul_A2419
Enzymes [BR:nmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Nmul_A2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABB75708
JGI: NmulA2419
UniProt: Q2Y6B3
Position
2756252..2756827
Genome map
AA seq 191 aa AA seqDB search
MDSNDSEFGIGDWQRLLRSLGEDPSRQGLRETPERVTRAWAHWTRGYKQDPAAILKTFAD
GGESYDELIVVRQIPVYSHCEHHLAPFFGHATIGYLPTGHIVGLSKLTRLVNCFAARLQV
QERLTQQVAQSLLEHLQPKAVGVILRCRHMCMESRGIAVAGEETVTSAMLGDLKTNAAQR
AEFLALAESHE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggattcaaatgattcagaattcggaatcggcgattggcagcgactgttgcgctctctc
ggcgaagaccccagccgccagggcctgcgcgaaacgccggagcgcgtgacacgcgcgtgg
gctcactggacgcgcgggtacaagcaggatccggcagcgatcctcaagacgttcgcggac
ggcggcgaaagctacgacgaattgatcgtagtgagacagatacccgtttactcgcactgc
gaacaccacctggctcccttttttggccacgcaaccatcgggtatctccccacgggtcat
atcgtcgggttgtccaaactgacgcgactggttaactgttttgcagctcgcctgcaggta
caggaacgcctgactcagcaggtggcacaatccctgctggagcacctgcaaccgaaggcg
gtcggcgtcattctccgctgccgccacatgtgcatggaatcgaggggaattgccgttgcc
ggggaagaaacggtaacgtcggccatgctgggcgacctgaaaacgaatgcagcgcagcgt
gccgagttcctggcattggccgagtcgcacgagtaa

DBGET integrated database retrieval system