KEGG   Nitrosospira multiformis: Nmul_A2445Help
Entry
Nmul_A2445        CDS       T00302                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmu  Nitrosospira multiformis
Brite
Enzymes [BR:nmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Nmul_A2445
Secretion system [BR:nmu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Nmul_A2445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2793326..2794045
Genome map
AA seq 239 aa AA seqDB search
MRSKLVSLALPSLLLCFLSSASADEASLKKALQANFPGEKVESIKKTPYLGLYEVVVGGE
LFYTDDKASYLFFGHVIDPKTKESLTSERLQQIKEARRIDVGSLPLQHAIKAVKGNGKRK
LVVFSDPNCPFCKRLEKELVNVTDVTIYTLLYPVLNGSTPTATAIWCSEDRLKAWEDFML
RNIMPASKDCATPIDVILKAGKENDISGTPTLIFANGSVTPGLIPAETIEKKLNAAPAK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcaaaactcgtttccctcgctttgccttctctattgctatgctttctttccagc
gcttccgctgacgaggcatccctgaaaaaagcgcttcaggcaaattttcccggagagaag
gtcgaaagcataaaaaaaaccccctatctcggtctatacgaagtggtggtgggaggcgaa
ttgttctatacggacgacaaggcttcgtacctttttttcggtcatgtaattgatccgaaa
acgaaggaaagcctgacttccgaacgcttgcaacaaatcaaggaggctcggcgcatagat
gtaggctctcttcccctgcagcatgcgatcaaggcggtcaaggggaatgggaaacgcaaa
cttgtcgttttctccgatccgaactgccctttttgcaaacgtctggaaaaggaactggtt
aacgtaacggatgtaacgatatataccctgctttatccagtgctgaacggttcgaccccg
accgcaacggcgatatggtgctcggaggacaggctcaaggcctgggaagatttcatgctc
aggaatatcatgcccgccagcaaggattgcgccacgcccatagatgtgattctcaaggca
gggaaagaaaacgatataagcggtacccctaccctgatttttgccaatggctcggtaacg
cccggattgattcctgcggagacgatagaaaagaaattaaacgcggctcctgcgaaatag

DBGET integrated database retrieval system