KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0265Help
Entry
NMAA_0265         CDS       T01931                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMAA_0265 (tpiA)
   01230 Biosynthesis of amino acids
    NMAA_0265 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMAA_0265 (tpiA)
   00051 Fructose and mannose metabolism
    NMAA_0265 (tpiA)
   00562 Inositol phosphate metabolism
    NMAA_0265 (tpiA)
Enzymes [BR:nmw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMAA_0265 (tpiA)
Exosome [BR:nmw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMAA_0265 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMAA_0265 (tpiA)
  Exosomal proteins of melanoma cells
   NMAA_0265 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308679..309452)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccagaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgcgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system