KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0267Help
Entry
NMAA_0267         CDS       T01931                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (protein-beta-aspartate methyltransferase; PIMT; protein L-isoaspartyl methyltransferase; L-isoaspartyl protein carboxyl methyltransferase) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310241..310897
Genome map
AA seq 218 aa AA seqDB search
MDFEKARFNMVEQQIRPWDVLDFDVLDALAEIPRELFVDEDLQGLAYADMALPLANGHKM
LEPKVVARLAQGLKLTKNDTVLEIGTGSGYATALLAKLAGRVVSDDIDAEQQNRAKAVLD
GLSLENIDYVQNNGLTELSAGAPFDAVYVGGAVNLVPEVLKEQLKDGGRMVVIVGRKPVQ
RALLITRKGDVFEEKVLFDTLVAHLDDKDADPFGGFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggattttgaaaaagcgcggttcaatatggtcgaacagcaaatccgtccgtgggatgta
ttggattttgacgttttggacgctttggcggagattccgcgcgagctttttgtcgatgag
gatttgcagggtttggcgtatgcggatatggcgctgccgcttgccaacggtcataagatg
ctggagccgaaagtcgtggcgcggctggcgcagggcttgaagctgacgaaaaacgatacg
gttttggaaatcggcacgggttcgggctatgcgaccgcgcttttggcaaaattggctggt
cgtgtggtgtcggacgacatcgatgccgaacagcaaaaccgcgccaaagcggtgttggac
ggcttgtctttggaaaacattgattatgtgcaaaacaacgggttgaccgaactttccgca
ggtgcgccgtttgatgcggtttatgtcggcggtgcggtaaaccttgtgcctgaagtgttg
aaagaacagttgaaagatggcggacgcatggtggttatcgtaggccgcaagcctgttcag
cgcgcgcttttgattacgcgcaagggcgatgtgtttgaagagaaggtgctgttcgatacc
ttggtggcgcatttggatgataaggatgccgatccgtttggcggttttcagttttga

DBGET integrated database retrieval system