KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0373Help
Entry
NMAA_0373         CDS       T01931                                 

Gene name
nagZ
Definition
beta-hexosaminidase(N-acetyl-beta-glucosaminidase;beta-N-acetylhexosaminidase) (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMAA_0373 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NMAA_0373 (nagZ)
Enzymes [BR:nmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NMAA_0373 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(467705..468790)
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTGEEKQRLLDPAIGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMNVLGQIWDKDGASAAETAAGQVGWVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHSNPEAVTRLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDGRSLDELEAADLIPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVIQTADFQAAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accggagaagaaaaacaacgcctgctcgaccccgcaatcggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacagctcaaaacactcaccgccgaaatcaaagcacttcgc
acacccgaactcattatcgccgtcgatcacgagggcggaagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgaacgttttagggcaaatttgggacaaagacggcgca
tccgccgccgaaaccgccgccggacaagtcggctgggttttggcaaccgagctttccgcc
tgcggcatcgacttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccacagtaaccccgaagccgtaacccgcctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacggg
tttgtcgaaggggacagccatttggtgctacccgaagacgggcgcagcctcgacgaactc
gaagccgccgacctcattcccttccgcattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgccgggttttccgaaatctgg
ctcaaacaaattttgcgccgcgacatcgggttcaaaggcgtgattttctcggacgatttg
actatggaaggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggatgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgttatacagacggcggatttccaagcggcgcaagcc
tttgttgccggtcttgcctcgccgcaagacacggcgggcggcgtaaaagtcggagaggcc
ttttaa

DBGET integrated database retrieval system