KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0389Help
Entry
NMAA_0389         CDS       T01931                                 

Definition
(RefSeq) putative alcohol dehydrogenase (ADH-HT) (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMAA_0389
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMAA_0389
  Lipid metabolism
   00071 Fatty acid degradation
    NMAA_0389
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMAA_0389
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMAA_0389
   00626 Naphthalene degradation
    NMAA_0389
Enzymes [BR:nmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMAA_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(488626..489672)
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATYCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaat
accggccgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggt
atggcgacctactgcatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggat
cctgcgcaagcttccagcattacttgtgccggcgtgaccacttataaagccattaaagtt
tccagtgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtatttggcgcacacgttgtcgccatcgacatcaacgac
gacaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgctgccgcattcaactctgccgtgaattgcgtccgcgcaggcggacgtgtggtt
gccatcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgcc
attttccaagaaatgcgcgaaggcaaaatcaccggccgtatggtaatcgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system