KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0514Help
Entry
NMAA_0514         CDS       T01931                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMAA_0514 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMAA_0514 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMAA_0514 (trpA)
Enzymes [BR:nmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMAA_0514 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625150..625935
Genome map
AA seq 261 aa AA seqDB search
MSRIRQAFAALDGGKALIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGP
VIQRAAERALANGISLRDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAG
VDGVLTVDSPVETIDPLYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGV
TGAASLDTDEVSRKIEYLHQYIDIPIGVGFGISNAESARKIGRVAEAVIVGSRIVKEIEN
NAGNEAAVVGALVKELKDAVR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaatccggcaggcttttgccgctttggatggcggaaaggcattgattccctat
attacggtgggcgaccccgatattcggacaactttggcattgatgcacggcatggttgca
aacggtgcggatattttggagttgggtgtgccgttttccgatccgatggcggatgggccg
gttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctgcgcgatgtcttg
gatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgttttgatgggatat
ttgaaccctgtacataagatgggttatcgggagtttgctcaggaagccgcaaaggcgggt
gtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccgctctatcgcgag
ctgaaggataacggggtcgactgtattttcctgattgcgccgacgacgacggaagaccgt
attaaaaccattgccgagctggcaggcggatttgtctattatgtttcgctcaagggcgta
acgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagagtatttgcatcag
tatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaaagcgcgcgcaaa
atcggccgggttgccgaagcggtcattgtcggcagccggattgtgaaagagattgaaaac
aatgcgggcaacgaggctgcggtcgtcggtgctttggtcaaagagttgaaggatgccgtg
cgctga

DBGET integrated database retrieval system