KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0579Help
Entry
NMAA_0579         CDS       T01931                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase (7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase; HPPK; 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase; PPPK) (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMAA_0579 (folK)
Enzymes [BR:nmw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NMAA_0579 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(696107..696601)
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDPRLTLPHPR
AHERSFVIRPLAEILPDFILGKHGKVAELSKRLGNQGIRLLPDK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcccgatttcgtcaatgcc
gtctgcaccgtttccaccaccttggacggcattgccctgcttgccgaactcaaccgtatc
gaagccgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacccccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatacgccctttggcagaaatcctccctgattttattttg
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggcatccgtctt
ttaccggataagtaa

DBGET integrated database retrieval system