KEGG   Neisseria meningitidis WUE 2594 (serogroup A): NMAA_0608Help
Entry
NMAA_0608         CDS       T01931                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase (UROS; uroporphyrinogen-III cosynthetase; hydroxymethylbilane hydrolyase [cyclizing])
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmw  Neisseria meningitidis WUE 2594 (serogroup A)
Pathway
nmw00860  Porphyrin and chlorophyll metabolism
nmw01100  Metabolic pathways
nmw01110  Biosynthesis of secondary metabolites
nmw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMAA_0608 (hemD)
Enzymes [BR:nmw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NMAA_0608 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CBY90480
Position
721428..722189
Genome map
AA seq 253 aa AA seqDB search
METVKPIMLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVF
WVSPTAVETAVPYLNLSDGIKMHISVGQGSRRVLERCLGRTVIAPEDGNDSEAVLRLTVW
NSLPEGARVLFVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYI
TSTELVRLLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSI
SVSDGMVFPGTSN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagtgaaacccatcatgctgattgtccgaccgtcgggcagggcgaaggacgat
gtggaaacctgccgtcgtgccggatggcaggcggaagtgttgagcccgattgaaatcgaa
gcagatgctgccggactggaacttttgtccgaacaatatgcccgtgcggatgccgtgttt
tgggtcagtccgaccgccgttgaaaccgccgtcccgtaccttaacctttcagacggcata
aagatgcacatttccgtagggcagggcagccgccgcgtattggaacgctgtttgggcaga
acggtcatcgcgcctgaagacggcaacgacagcgaggcggttttgcgcctgacggtttgg
aacagtctgcccgaaggtgcgcgcgtattgtttgtgcgcggacacggcgggcgggatttt
ctgatgaatgccttgcaggagaaaggttttcggacggaggtggcagaagtctatttcaga
cggcataaacctttgaactttcaaaatttccaaaccgaaaatattgccgccgcctatatt
acgtccacagaactcgtgcgcttgctgttcggacagcttccgccgcaattttcccgattc
ttcaaatccttgctatactttacccatcatccgcgcattgcggaggcattgaagcgcgaa
ggcgtgtgttcggtcgaaaccgtccctacgctggaagccgcgctttcccattcttccatt
tccgtttcagacggcatggtctttcccggaacctcaaattaa

DBGET integrated database retrieval system